DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stc and FAP1

Sequence 1:NP_476599.1 Gene:stc FlyBaseID:FBgn0001978 Length:1106 Species:Drosophila melanogaster
Sequence 2:NP_014375.1 Gene:FAP1 SGDID:S000004968 Length:965 Species:Saccharomyces cerevisiae

Alignment Length:848 Identity:250/849 (29%)
Similarity:369/849 (43%) Gaps:161/849 (19%)


  Fly   310 NKRRDDWNRNRDRINGFPRAVDDLDTSNESAHPSP-EKQSQLQQISPRRGPPLPPADNEKLSQRE 373
            |:...|..|:.:..:|...:|:|   :||  .||. |::|                 ::.:...|
Yeast    12 NQDGGDTYRHHNLSDGCISSVED---ANE--QPSSYEEES-----------------DDDMQYYE 54

  Fly   374 KLVRDIEQ-RRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSSKSEVG---WRCPACQN 434
            :.:::|.. ....|::|...:......::|:.||.:....|...||..|..:..   |:||.|..
Yeast    55 RAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYY 119

  Fly   435 VLQDLP--RDYLCFCGKLKNPPVSRTELAHSCGEVCCRIEGCSHACTLLCHPGPCPPCQANVVRS 497
            |.:.:|  ....|:|||:.||..:..: .:|||:. |....|.|.|:.:||.||.|.|...|...
Yeast   120 VSKRVPVKNRPTCWCGKVVNPDPNPLD-PNSCGQT-CNASTCMHGCSKICHLGPHPECTRMVEIM 182

  Fly   498 CGCGRSTKTMQC----AMKEEVLCGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQ-------- 550
            |.||:.:|::.|    .||:...|.|:|...|:|..|.|:.:||.|.|..|.|.::.        
Yeast   183 CHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQI 247

  Fly   551 QCHCGKQER-KVPCT--------RESQDKR------TYSCKDSCGQPLPCGHHKCKDSCHA---- 596
            :|:||...| .:.|:        :.|:|:.      .::|.|:......|..|...:||.:    
Yeast   248 KCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTI 312

  Fly   597 GSCRPCKLSPEQITSCPCGKMPVP--AGQRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSKCHL 659
            ...:.|...|..:.:||||:..:.  ...|..|.||||||:..|.:.|:|||    |.|...||.
Yeast   313 NGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGK----HSCPFTCHD 373

  Fly   660 GQC-PPCPKQTGVKCRCGHMDQMIKCRQLCNRADDARCKRRCTKKRSCGKHKCNVECC------- 716
            ..| .||.:...|||.|......:.    |......||..:|....||.:|:|...||       
Yeast   374 KACMEPCLQIDSVKCACEQSTFSVP----CGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAI 434

  Fly   717 -----------------IDIDHDCPLPCNRTLSCGKHKCDQPCHRGNCPPCYRSSFEELYCECGA 764
                             ::..|.|..|||.|||||.|||.:.||.|.||||..|...:|.|.||.
Yeast   435 RRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGN 499

  Fly   765 EVIYPPVPCGTKKPICKLPCSRI----HPCDHPPQ-HNCHS-GPTCPPCMIFTTKLCHGNHELRK 823
            .|:..||.||||.|.|..||.::    ..|.|.|. |.||| ..:||||.....|.|....:.:.
Yeast   500 TVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKV 564

  Fly   824 TIPCSQPNFSCGMACGKPLPCGGHKCIKPCH-EGPCQSAGEICRQSCTKPRPTCGHKCAAACH-E 886
            ...|.|.:.|||:.||.||....|.|.|.|| .|.||   ::|:|:|.:.|..|.|:|...|| :
Yeast   565 RTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNCQ---KVCKQTCGQKRLNCNHECPKPCHGK 626

  Fly   887 GACPETPCKELVEVQCECGNRKQNRSCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAK 951
            ..||:.||..||::.|:||..|::.:|   ..:..|:       |:.|.|               
Yeast   627 TECPDLPCATLVKIYCKCGRIKKSVTC---GAKSDRV-------SVTESS--------------- 666

  Fly   952 KSNKTLDCNDECRLLERNRRLAAA---------LSSGNSDTKQKCL---TKYSEFVRGFAKKNPA 1004
                .||||:||..|:|.:.|..|         .:|...|..:|.:   |.:.|....|.:  .|
Yeast   667 ----VLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLPFTE--AA 725

  Fly  1005 LTKSVY-------ETLTDLVKLAKESKQRSRSHSFPTMNREKRQLVHELCEVFGIESVSYDKEPN 1062
            |  |||       ..:..::....:.|.||..| |..|...:|..:.||.:.:|:.|.|.|:||.
Yeast   726 L--SVYSKQERWCSQIEAILNKLMDDKTRSSLH-FKPMRPPQRHFIRELAKAYGLYSESQDREPM 787

  Fly  1063 RNV 1065
            |:|
Yeast   788 RSV 790

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stcNP_476599.1 NF-X1-zinc-finger 464..510 CDD:100116 18/50 (36%)
NF-X1-zinc-finger 517..565 CDD:100116 18/65 (28%)
NF-X1-zinc-finger 575..617 CDD:100116 12/46 (26%)
NF-X1-zinc-finger 634..686 CDD:100116 17/53 (32%)
NF-X1-zinc-finger 723..775 CDD:100116 29/52 (56%)
NF-X1-zinc-finger 834..882 CDD:100116 21/49 (43%)
NF-X1-zinc-finger 865..915 CDD:100116 20/51 (39%)
R3H_NF-X1 996..1069 CDD:100072 23/78 (29%)
FAP1NP_014375.1 NF-X1-zinc-finger 150..196 CDD:100116 18/47 (38%)
NF-X1-zinc-finger 206..263 CDD:100116 18/57 (32%)
NF-X1-zinc-finger 352..400 CDD:100116 18/56 (32%)
NF-X1-zinc-finger 458..505 CDD:100116 25/47 (53%)
NF-X1-zinc-finger 604..655 CDD:100116 20/54 (37%)
R3H_unknown_2 736..794 CDD:100076 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337472624
eggNOG 1 0.900 E1_KOG1952
Hieranoid 1 1.000
Homologene 1 1.000 H1875
Inparanoid 1 1.050 377 1.000 Inparanoid score I339
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003814
OrthoInspector 1 1.000 T1135728
orthoMCL 1 0.900 OOG5_128867
Panther 1 1.100 LDO PTHR12360
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R432
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.