DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stc and Nfx1

Sequence 1:NP_476599.1 Gene:stc FlyBaseID:FBgn0001978 Length:1106 Species:Drosophila melanogaster
Sequence 2:NP_001019955.2 Gene:Nfx1 RGDID:1310277 Length:1114 Species:Rattus norvegicus

Alignment Length:976 Identity:379/977 (39%)
Similarity:525/977 (54%) Gaps:87/977 (9%)


  Fly   193 TTNGNSTASLETAINETRPRTLRAQEPAE----------RGANNQCS---NHNYERERERERDRD 244
            |...:.|:|||:..........|...|:|          |||..:.:   .:||.|         
  Rat   122 TEQTSDTSSLESVARSESGTNPREHSPSESEKEVVIADPRGAKPKKATQLTYNYGR--------- 177

  Fly   245 RDRERDRDRDRDRDRDRDRDRDRDSRP------GNTRQQRRSDYRDDREDRYERSDRRR-PQKQQ 302
            ..:.:.|.|....:|...:..|.::||      .::....|....|....|  ||::|| |||:.
  Rat   178 GPKAKGRLRSEWGNRMSPKSEDENARPVAISHSDSSEASCRKPVVDPCVCR--RSEQRRYPQKRP 240

  Fly   303 RYDNHRSNKR--RDDWNRNRDR-INGFPR------AVDDL---------DTSN------ESAHPS 343
            .::...:..|  |:...:...| ||..|:      ..|:|         ||.|      .|....
  Rat   241 PWEVEGARPRPGRNPPKQESQRHINAGPKNNMPPLPKDNLRERPTKSACDTGNLAVVTKSSRRVD 305

  Fly   344 PEKQSQLQQISPRRGPPLPPA-DNEKLSQRE----KLVRDIEQRRLECLVCVEAIKSHQPTWSCR 403
            .||.:..:| .|:...|.|.. .|..|...|    .|:..:...:.||:||.|.::...|.|||:
  Rat   306 QEKNAGRRQ-DPQVLSPFPRGKQNHMLKNVETHTGSLIEQLTTEKYECMVCCELVQVTAPVWSCQ 369

  Fly   404 NCYHMLHLKCTITWASSSKS----EVGWRCPACQNVLQDLPRDYLCFCGKLKNPPVSRTELAHSC 464
            :|:|:.||.|...||.|..|    :.||||||||||...:|..|.|||||:|||..||.|:.|||
  Rat   370 SCFHVFHLNCIKKWARSPASHADGQSGWRCPACQNVSAHVPSTYTCFCGKVKNPEWSRNEIPHSC 434

  Fly   465 GEVCCRI---EGCSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCAMKEEVLCGEICDKLLN 526
            ||||.:.   :.|.|:|.|||||||||||.|...::|.|||:..|::|.....|.|..:|:.:||
  Rat   435 GEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFTTKTCECGRTRHTVRCGQPVSVHCSNVCENILN 499

  Fly   527 CGEHRCQAECHSGKCAACSEQVVQQCHCGKQERKVPC---TRESQDKRTYSCKDSCGQPLPCGHH 588
            ||:|||...||:|:|..|...:.|.|:||...|.|.|   ..:|.....:||...||:.|.||.|
  Rat   500 CGQHRCAELCHAGQCQPCRIILNQVCYCGSTSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGSH 564

  Fly   589 KCKDSCHAGSCRPCKLSPEQITSCPCGKMPVP------AGQRSSCLDPIPTCEGICSRTLRCGKP 647
            .|...||...|:||...|..:..||||:.|:.      :..|.:|:||:|:|..:|.:.|.||..
  Rat   565 TCSQVCHPQPCQPCPRLPHLVRYCPCGQTPLSQLLEHGSNGRKTCMDPVPSCGKVCGKPLSCGSS 629

  Fly   648 AHPHQCGSKCHLGQCPPCPKQTGVKCRCGHMDQMIKCRQLCNRADDA--RCKRRCTKKRSCGKHK 710
            ...|.|...||.|.|.||.:.:.:.|||....:.:.|..|  :::||  .|.:||.|||.||:||
  Rat   630 DFIHTCEKLCHEGDCGPCSRTSVISCRCSFRTKELPCTSL--KSEDATFMCDKRCNKKRLCGRHK 692

  Fly   711 CNVECCIDIDHDCPLPCNRTLSCGKHKCDQPCHRGNCPPCYRSSFEELYCECGAEVIYPPVPCGT 775
            ||..||:|.:|.|||.|.|.|.||.|:|::|||||||..|:::||:||.|.|||.||||||||||
  Rat   693 CNEICCVDKEHKCPLICGRKLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGT 757

  Fly   776 KKPICKLPCSRIHPCDHPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGK 840
            :.|.|...|:|||.||||..|:|||...||||...|.|.|.|.||||..|||...:.|||:.|..
  Rat   758 RPPECTQTCARIHECDHPVYHSCHSEEKCPPCTFLTQKWCMGKHELRSNIPCHLVDISCGLPCSA 822

  Fly   841 PLPCGGHKCIKPCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEG-ACPETPCKELVEVQCEC 904
            .||||.|||.:.||:|.| ...|.|:|.||.||..|||.|.|.||.. .||.|.||..||:||||
  Rat   823 MLPCGMHKCQRLCHKGEC-LVDEACKQPCTTPRADCGHPCMAPCHPSLPCPVTACKAKVELQCEC 886

  Fly   905 GNRKQNRSCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECRLLERN 969
            |.||:...|.|.:..:.|||.|.:||.:.:|..|:.:|:|:.:...:.....|.|::||..|||.
  Rat   887 GRRKEMVICSEASGTYQRIAAISMASKITDMQLGDSVEISKFITKKEVQQARLQCDEECAALERK 951

  Fly   970 RRLAAALS-SGNSD--TKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESKQRSRSHS 1031
            :|||.|.. :.:||  ..:...:|:|:.::..|:|:......:.:.:..||:...:.|...:|:.
  Rat   952 KRLAEAFDITDDSDPFNVRSSASKFSDSLKDDARKDFKFVSDIEKEMEALVEAVNKGKSNKKSYC 1016

  Fly  1032 FPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDRCWFPATSIMEVLARESGQRRVPV 1096
            ||.|||:.|:::|:|.:|:|:||||||.||.||||.||.:.:...|.|::..|:.||: |.|.|.
  Rat  1017 FPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSICPPTTLTSVIERET-QTRPPP 1080

  Fly  1097 P 1097
            |
  Rat  1081 P 1081

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stcNP_476599.1 NF-X1-zinc-finger 464..510 CDD:100116 26/49 (53%)
NF-X1-zinc-finger 517..565 CDD:100116 21/51 (41%)
NF-X1-zinc-finger 575..617 CDD:100116 18/42 (43%)
NF-X1-zinc-finger 634..686 CDD:100116 17/52 (33%)
NF-X1-zinc-finger 723..775 CDD:100116 35/52 (67%)
NF-X1-zinc-finger 834..882 CDD:100116 25/48 (52%)
NF-X1-zinc-finger 865..915 CDD:100116 28/51 (55%)
R3H_NF-X1 996..1069 CDD:100072 29/73 (40%)
Nfx1NP_001019955.2 NF-X1-zinc-finger 490..538 CDD:100116 21/48 (44%)
NF-X1-zinc-finger 551..593 CDD:100116 18/42 (43%)
NF-X1-zinc-finger 616..668 CDD:100116 17/52 (33%)
NF-X1-zinc-finger 678..726 CDD:100116 29/48 (60%)
NF-X1-zinc-finger 705..757 CDD:100116 35/52 (67%)
NF-X1-zinc-finger 816..861 CDD:100116 24/46 (52%)
R3H_NF-X1 981..1054 CDD:100072 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337457772
eggNOG 1 0.900 E1_KOG1952
Hieranoid 1 1.000
Homologene 1 1.000 H1875
Inparanoid 1 1.050 736 1.000 Inparanoid score I557
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003814
OrthoInspector 1 1.000 T1086323
orthoMCL 1 0.900 OOG5_128867
Panther 1 1.100 LDO PTHR12360
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.