DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stc and SPCC18.03

Sequence 1:NP_476599.1 Gene:stc FlyBaseID:FBgn0001978 Length:1106 Species:Drosophila melanogaster
Sequence 2:NP_588382.1 Gene:SPCC18.03 PomBaseID:SPCC18.03 Length:1077 Species:Schizosaccharomyces pombe

Alignment Length:998 Identity:312/999 (31%)
Similarity:439/999 (44%) Gaps:209/999 (21%)


  Fly   142 SVNPSN-SNFSSFYTPFGNNPFDFSASKLQ--------ASAPEFVPNFAKLSLEETPAAATTNGN 197
            |::||: |...:|.|....|..:...|..:        ||||.|||. :.:.|.    .:..||:
pombe    31 SISPSSGSELPNFKTTISQNNEEVKTSLKEDSSKFHPSASAPIFVPT-SSVQLN----VSKNNGH 90

  Fly   198 STASLETAINETRPRTLRAQEPAERGANNQCSNHNYERERERERDRDRDRERDRDRDRDRDRDRD 262
            ..:.:..|::                            .::.|..:....|..|.::|.|.....
pombe    91 KASDIVDAVS----------------------------SKDEELRKHAKGEGKRSKNRKRSSKHS 127

  Fly   263 RDRDRDSRPGNTRQQRRSDYRDDREDRYERSDRRRPQKQQRYDNHRSNKRRDDWNRNRDRINGFP 327
            ..:..|.:..|:.|:..|    .:.....:|:|.|..|.:...|.:..|:               
pombe   128 EKQAVDLKSSNSSQETSS----SKGSVNNKSERSREAKSRMPKNSKEIKK--------------- 173

  Fly   328 RAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPLPPADNEKLSQREKLVRDIEQRRLECLVCVEA 392
                .||.|                               ||....:::.:::.|..||.||.:.
pombe   174 ----GLDLS-------------------------------KLDMTSRMIVELKNRLYECSVCTDT 203

  Fly   393 IKSHQPTWSCRNCYHMLHLKCTITWASSS---KSEVGWRCPACQNVLQDLPRDYLCFCGKLKNPP 454
            |......|||..|||:.||.|...|..:|   ::|..||||.||:...:....|||:|||.:.|.
pombe   204 INPSTSIWSCGTCYHVFHLSCIRKWCKNSIEQRNEDAWRCPYCQSNQTETSLHYLCWCGKQEKPE 268

  Fly   455 VSRTELAHSCGEVCCRIEG--CSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCA-----MK 512
            ..:..:.||||:.|.:..|  |.|.|.|||||||||||.|.|.:.|.||:.:...:|:     ..
pombe   269 FVKNLVPHSCGDPCGKTRGQDCEHPCPLLCHPGPCPPCTATVEKFCLCGKESIHARCSNISKVNT 333

  Fly   513 EEVLCGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQQCHCGKQERKVPCTR------ESQDKR 571
            |...|..:||:||.||||.|:..||||.|.||.|.:..:|:||...:..||:.      ..:|:.
pombe   334 EPFRCENVCDELLPCGEHTCKKRCHSGLCGACFEPINAKCYCGLHSKTYPCSSLPSPSISKKDEN 398

  Fly   572 --------TYSCKDSCGQPLPCGHHKCKDSCH--AGSCRPCKLSPEQITSCPCGKMPV----PAG 622
                    .|||.:.|.....||.|||..:||  :.:...|..:.:.:|.|||||..:    ...
pombe   399 GSVKEWFGYYSCNNPCTLFFDCGLHKCSKTCHPISETRAHCPFATDVLTKCPCGKEDISFLLKGH 463

  Fly   623 QRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSKCHLGQCPPCPKQTGVKCRCGHMDQMIKCRQL 687
            :|.||.|||||||.||.:.|.||     |:|..|||||.|..|.:...:.|||...:..:.|.||
pombe   464 ERKSCSDPIPTCENICGKLLSCG-----HRCKYKCHLGSCGTCSETLTIPCRCTANEVQVTCEQL 523

  Fly   688 CNRADDARCKRRCTKKRSCGKHKCNVECC---------------------------IDIDHDCPL 725
            .| .....|:|.||...|||:|:||.:||                           .:.:|.|..
pombe   524 QN-GFIPTCERLCTILLSCGRHQCNKKCCSGYSKAQTRLARRPKGAKLRYHLLTEEFEEEHICFR 587

  Fly   726 PCNRTLSCGKHKCDQPCHRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLPCSRIHPC 790
            |||:.||||.|.|...||||.||.|..:|||||.|.||...:||||.|||..|.|...|.....|
pombe   588 PCNKKLSCGNHFCQHMCHRGPCPRCLEASFEELPCTCGRTRLYPPVACGTPIPDCPYLCVLPKSC 652

  Fly   791 DHPP-QHNCHSGPT---CPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPCGGHKCIK 851
            .||. :||||  ||   ||||..|..|.|.....:.:..||.:.|..||..|.|.|.|..|.|.|
pombe   653 HHPQVKHNCH--PTSEPCPPCPYFVKKRCLCGKHILENQPCYRENVRCGELCNKLLSCKTHFCEK 715

  Fly   852 PCH-EGPCQSAGEICRQSCTKPRPTCGHKCAAACHEG-ACPE-TPCKELVEVQCECGNRKQNRSC 913
            .|| :|.|:|:   |::.|.|.|..|.|.|.:.||.| .|.| .|||..:||.||||..::..:|
pombe   716 LCHPDGECESS---CKKECGKRRMYCEHVCQSPCHAGHPCDERIPCKAPLEVSCECGRIRKKVTC 777

  Fly   914 QELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECRLLERNRRLAAALSS 978
                                :.|..|       ..|..|.:.||:|:.:    :||:..|.||:.
pombe   778 --------------------DASYDN-------PDPQHKVSCTLECSQQ----QRNKLFAEALNI 811

  Fly   979 GNSDTKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESKQRSRSHSFPTMNREKRQLV 1043
             .:|.:...:.:|::.:..|..|:......|...|.:.|      ..::.|..||:|.||:|..|
pombe   812 -KTDRRSNDVAQYTKSLLVFYGKHSDFADEVESLLRNFV------NNKASSFRFPSMRREQRAFV 869

  Fly  1044 HELCEVFGIESVSYDKEPNRNVV 1066
            |...::.|:||||:|.||.|||:
pombe   870 HMFAKLLGLESVSFDPEPKRNVM 892

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stcNP_476599.1 NF-X1-zinc-finger 464..510 CDD:100116 24/48 (50%)
NF-X1-zinc-finger 517..565 CDD:100116 23/48 (48%)
NF-X1-zinc-finger 575..617 CDD:100116 16/44 (36%)
NF-X1-zinc-finger 634..686 CDD:100116 20/52 (38%)
NF-X1-zinc-finger 723..775 CDD:100116 31/52 (60%)
NF-X1-zinc-finger 834..882 CDD:100116 21/49 (43%)
NF-X1-zinc-finger 865..915 CDD:100116 22/52 (42%)
R3H_NF-X1 996..1069 CDD:100072 25/72 (35%)
SPCC18.03NP_588382.1 NF-X1-zinc-finger 278..326 CDD:100116 24/48 (50%)
NF-X1-zinc-finger 338..386 CDD:100116 23/48 (48%)
NF-X1-zinc-finger 475..520 CDD:100116 19/50 (38%)
NF-X1-zinc-finger 585..637 CDD:100116 31/52 (60%)
NF-X1-zinc-finger 698..742 CDD:100116 20/47 (43%)
NF-X1-zinc-finger 727..777 CDD:100116 21/50 (42%)
R3H_unknown_2 838..895 CDD:100076 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1875
Inparanoid 1 1.050 516 1.000 Inparanoid score I225
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003814
OrthoInspector 1 1.000 T1124481
orthoMCL 1 0.900 OOG5_128867
Panther 1 1.100 LDO PTHR12360
Phylome 1 0.910 0.688 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R432
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.