DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stc and nfx-1

Sequence 1:NP_476599.1 Gene:stc FlyBaseID:FBgn0001978 Length:1106 Species:Drosophila melanogaster
Sequence 2:NP_498394.1 Gene:nfx-1 WormBaseID:WBGene00007048 Length:1119 Species:Caenorhabditis elegans

Alignment Length:978 Identity:347/979 (35%)
Similarity:483/979 (49%) Gaps:87/979 (9%)


  Fly   192 ATTNGNSTASLETAINETRPRTLRA------QEPAERGAN-----------NQCSNHNYERERER 239
            |.|.|.| :|:.|:.|.:|.|..|.      |.|.:.|||           |....|......:|
 Worm     2 ADTEGTS-SSIPTSTNSSRHRASRGRGGRFRQAPRQVGANTADNLDAAPLMNPRGGHRGGSGNKR 65

  Fly   240 ERDRDRDRERDRDRDRDRDRDRDRDRDRDSRPG----------------------NTRQQRRSDY 282
            .|.:.......|.:.:...............|.                      |:|||..|..
 Worm    66 GRGQKEATSASRLQMQPEANFTFNPNAATFNPAQSVLFDPSVPPPTIGASTHSNQNSRQQEPSQN 130

  Fly   283 RDDREDRYERSDRRRPQKQQRYDNHRSNKRRDDWNRNR---DRI-NGFPRAVDDLDTSNESAHPS 343
            |..|..:.....|:...::||.|:|..|:.|.: |||:   ||| |...::|     .|.|.:|.
 Worm   131 RRRRGGQQNTQRRQLEIQEQRGDSHPQNQSRQN-NRNQLNVDRIANQQNKSV-----QNPSRNPG 189

  Fly   344 PEKQSQLQQISPRRGPPLPPADNEKLSQ---REKLVRDIEQRRLECLVCVEAIKSHQPTWSCRNC 405
            ..::.|..:...::..||...:.:.|:.   ||.||..:|..:.||.:|...|.:.|..|||:.|
 Worm   190 NSRRGQGARRREQKEEPLTEEETKILADKPLREGLVYLLENNKYECAICYTRITTRQGVWSCKTC 254

  Fly   406 YHMLHLK--CTITWASSSKSEVG---WRCPACQNVLQDLPRDYLCFCGKLKNPPVSRTELAHSCG 465
            ||:.|:.  |...||.||:.:.|   ||||.||...:.:|.:|.||||:::||.....|:.||||
 Worm   255 YHIFHISTGCITDWARSSRDKEGANTWRCPTCQTENETMPYNYYCFCGRMRNPNFRVGEVPHSCG 319

  Fly   466 EVC--CRIEGCSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCAMKEEVLCGEICDKLLNCG 528
            |.|  .|..||.|.||.|||||||..|:....:||.||::.|:::|...:||:|..:|.|.|:||
 Worm   320 ETCGGARKFGCPHPCTELCHPGPCIECKLFTTKSCNCGKTKKSVRCGSDQEVMCETVCGKQLSCG 384

  Fly   529 EHRCQAECHSGKCAACSEQVVQQCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDS 593
            :|.|:..||||.|..|:..:.|.|.|||..::|.|...:.:|  |||...|.....||.|.|...
 Worm   385 QHNCERICHSGDCGECTVILEQDCFCGKTPKEVSCNPCAHEK--YSCGSECDGMFSCGIHHCTKK 447

  Fly   594 CHAGSCRPCKLSPEQITSCPCGKMPVPA--GQRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSK 656
            ||...|..|:....:|.:||||:..:.:  ..|..|.|.:|||:.:|.:.|.||.|...|.|..|
 Worm   448 CHDKECGECETGANRIRTCPCGRNTLQSLGVTRKKCTDMVPTCDSVCDKWLTCGTPGKNHHCREK 512

  Fly   657 CHLGQCPPCPKQTGVKCRCGHMDQMIKC---RQLCNRADDARCKRRCTKKRSCGKHKCNVECCID 718
            ||.|.||||...|.|.||||....:|.|   .|:.....:..|.:||.||:|||.|||...|||.
 Worm   513 CHEGPCPPCNLNTSVICRCGTSKGVIPCDEYLQIMKTTGEYLCTKRCRKKKSCGMHKCQEVCCIQ 577

  Fly   719 IDHDCPLPCNRTLSCGKHKCDQPCHRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLP 783
            .:|.|...||:.||||.|.|:..||.|.|.||.::||:|.:|.||..|..||:|||.:.|:|..|
 Worm   578 DEHFCLQMCNKRLSCGIHTCENVCHAGQCRPCLQASFDEQFCHCGHTVRMPPIPCGARLPVCSQP 642

  Fly   784 CSRIHPCDHPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPCGGHK 848
            |.|.|.|||...|.||....||||...|.|:|:|.|.:||.|||...:.|||:.|.|||.||.|.
 Worm   643 CVRPHSCDHSVSHKCHGEQNCPPCTQLTEKMCYGGHRVRKNIPCHIDSVSCGVVCKKPLKCGVHV 707

  Fly   849 CIKPCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEGA-CPETPCKELVEVQCECGNRKQNRS 912
            |.:.||...|:..||.|.:.|...|..|.|.||..|||.: |..:|||..|.:.||||..|::..
 Worm   708 CQRTCHGEECEKEGEKCTKKCETIRELCEHPCALPCHEDSPCEPSPCKASVRISCECGRIKKDAP 772

  Fly   913 CQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLD---CNDECRLLERNRRLAA 974
            |.|:  :...::.::........|.|....:.|.:.....|...|:   |:|||:.|||||::|.
 Worm   773 CCEV--DKMILSKLEKEEEEKSESDGEEKVVKEGILKRSTSFSQLNCMKCDDECKKLERNRKVAE 835

  Fly   975 ALSSGNSDTKQKCLTKYSE------FVRGFAKKNPALTKSVYETLTDLV--KLAKESKQRS-RSH 1030
            ||   ..||.:..:.|.:.      :::...:.|....|||.:.|.|||  .|:.|:...: |:|
 Worm   836 AL---EVDTDEYGMNKLAPTISFPCYLKEMVRTNIDFVKSVEKILIDLVIQILSGEAYHDTFRAH 897

  Fly  1031 SFPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDRCWFPATSIMEVLARESGQRRVP 1095
             .|.|:.|||:.|||....|.|.|.|.|..|.|::|.||.:.:...|...|.: |....|..:.|
 Worm   898 -LPAMSIEKRRFVHEYANFFNIASESVDSPPKRSIVLTAVRGKSHQPLVLISD-LVNYKGALKTP 960

  Fly  1096 VPS 1098
            .|:
 Worm   961 GPA 963

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stcNP_476599.1 NF-X1-zinc-finger 464..510 CDD:100116 24/48 (50%)
NF-X1-zinc-finger 517..565 CDD:100116 21/48 (44%)
NF-X1-zinc-finger 575..617 CDD:100116 15/42 (36%)
NF-X1-zinc-finger 634..686 CDD:100116 24/55 (44%)
NF-X1-zinc-finger 723..775 CDD:100116 27/52 (52%)
NF-X1-zinc-finger 834..882 CDD:100116 22/48 (46%)
NF-X1-zinc-finger 865..915 CDD:100116 21/51 (41%)
R3H_NF-X1 996..1069 CDD:100072 29/76 (38%)
nfx-1NP_498394.1 NF-X1-zinc-finger 318..367 CDD:100116 24/49 (49%)
NF-X1-zinc-finger 373..419 CDD:100116 20/46 (43%)
NF-X1-zinc-finger 429..472 CDD:100116 15/43 (35%)
NF-X1-zinc-finger 490..542 CDD:100116 24/52 (46%)
NF-X1-zinc-finger 582..634 CDD:100116 27/52 (52%)
NF-X1-zinc-finger 693..740 CDD:100116 21/47 (45%)
R3H 860..935 CDD:294210 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337455124
eggNOG 1 0.900 E1_KOG1952
Hieranoid 1 1.000
Homologene 1 1.000 H1875
Inparanoid 1 1.050 641 1.000 Inparanoid score I439
Isobase 1 0.950 0 Normalized mean entropy S2168
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003814
OrthoInspector 1 1.000 T476613
orthoMCL 1 0.900 OOG5_128867
Panther 1 1.100 LDO PTHR12360
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R432
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.