DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stc and NFXL1

Sequence 1:NP_476599.1 Gene:stc FlyBaseID:FBgn0001978 Length:1106 Species:Drosophila melanogaster
Sequence 2:NP_001265552.1 Gene:NFXL1 HGNCID:18726 Length:911 Species:Homo sapiens

Alignment Length:778 Identity:233/779 (30%)
Similarity:330/779 (42%) Gaps:184/779 (24%)


  Fly   365 DNEKLSQREKLVRDIEQR-RLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSS------- 421
            |..:|.:.::.|.:..|. .:.||:|:.::|.:|..|||..|:.:.|:.|...||..|       
Human   138 DTRELERTKQYVNEAFQAGAMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSV 202

  Fly   422 ------KSEVGWRCPAC--QNVLQDLPRDYLCFCGKLKNPPVSRTELAHSCGEVCCR--IEGCSH 476
                  |.:..|.||.|  :....:.|..|.|:|||:::||:....:.||||:||.|  ...|.|
Human   203 TDDDFGKKDCPWPCPKCRFEYKRSETPSRYYCYCGKVEDPPLDPWLVPHSCGQVCEREFKPPCGH 267

  Fly   477 ACTLLCHPGPCPPCQANVVRSCGCGRSTK-TMQCAMKE---EVLCGEICDKLLNCGEHRCQAECH 537
            .|.|||||||||||...|..:|.|.::.. ..:|:.||   ::.||:   ||| ||:|:|:..||
Human   268 KCLLLCHPGPCPPCPKMVTTTCYCKKAKPIPRRCSAKEWSCQLPCGQ---KLL-CGQHKCENPCH 328

  Fly   538 SGKCAACSEQVVQQCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPC 602
            :|.|..|.....|:|.|||:..:..|.     ...:.|...||:.||||:|.|:..||.|:|..|
Human   329 AGSCQPCPRVSRQKCVCGKKVAERSCA-----SPLWHCDQVCGKTLPCGNHTCEQVCHVGACGEC 388

  Fly   603 KLSPEQITSCPC--GKMPVPAGQRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSKCHLGQCPPC 665
            ..|.::.  |||  .|..:|      |.:.:|||...|.:.|.||    .|:|..:||.|.|..|
Human   389 PRSGKRF--CPCQKSKFSLP------CTEDVPTCGDSCDKVLECG----IHRCSQRCHRGPCETC 441

  Fly   666 PKQTGVKCRCGHMDQMIKCRQLCNRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRT 730
            .::....||||...:.:.|.:      ...|:.:|.|.|.|.||:|..:||......|...|.||
Human   442 RQEVEKHCRCGKHTKRMPCHK------PYLCETKCVKMRDCQKHQCRRKCCPGNCPPCDQNCGRT 500

  Fly   731 LSCGKHKCDQPCHRGNCPPCYRSSFEELYCECGAEVIYPPVPCG----TKKPICKLPCSRIHPCD 791
            |.|..|||...||||:|.||..:  .::.|.||...:  .||||    |:.|.||..|||...|.
Human   501 LGCRNHKCPSVCHRGSCYPCPET--VDVKCNCGNTKV--TVPCGRERTTRPPKCKEQCSRPPTCH 561

  Fly   792 HPPQ--HNCHSG-------------------------------------PT-------------- 803
            |..|  |.||.|                                     ||              
Human   562 HTSQEKHRCHFGSCPPCHQPCQKVLEKCGHLCPAPCHDQALIKQTGRHQPTGPWEQPSEPAFIQT 626

  Fly   804 ---CPPCMIFTTKLCHGNHELRKTIPCSQPN-FSCGMACGKPLPCGGHKCIKPCHE--------G 856
               ||||.:.....|.|.||: ..:||.... :||...||:.|.|..|.|:|.||:        |
Human   627 ALPCPPCQVPIPMECLGKHEV-SPLPCHAVGPYSCKRVCGRILDCQNHTCMKECHKVTKTDGCTG 690

  Fly   857 PCQSAGEI--CRQSCTKPRPT-CGHKCAAACHEGACPETPCKELVEVQCECG------------- 905
            ..::..|.  |.:.|:|.||. |.|.|...||.|.||  ||.:::.::|.|.             
Human   691 KNKAGPECLHCEEGCSKSRPLGCLHPCILRCHPGECP--PCVQMLRIKCHCKITSLYVECRKITT 753

  Fly   906 ---NRKQNRSC------QELAREHSRIATIQLASSMAEMSRG-----NYMELSEILAPAKKSNKT 956
               |.|...||      :||...|          ...||...     |..:..::..|.|:..|.
Human   754 ADVNEKNLLSCCKNQCPKELPCGH----------RCKEMCHPGECPFNCNQKVKLRCPCKRIKKE 808

  Fly   957 LDCND--------EC-RLLERNRRLAAALSSGNSDT--------KQKCLTKYSEFVRGFAKKN 1002
            |.||.        || ...:..:|.|:.:....:..        :|..|..:...::|..|||
Human   809 LQCNKVRENQVSIECDTTCKEMKRKASEIKEAEAKAALEEEKRRQQAELEAFENRLKGRRKKN 871

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stcNP_476599.1 NF-X1-zinc-finger 464..510 CDD:100116 23/49 (47%)
NF-X1-zinc-finger 517..565 CDD:100116 20/48 (42%)
NF-X1-zinc-finger 575..617 CDD:100116 19/44 (43%)
NF-X1-zinc-finger 634..686 CDD:100116 17/52 (33%)
NF-X1-zinc-finger 723..775 CDD:100116 23/56 (41%)
NF-X1-zinc-finger 834..882 CDD:100116 20/59 (34%)
NF-X1-zinc-finger 865..915 CDD:100116 21/73 (29%)
R3H_NF-X1 996..1069 CDD:100072 4/8 (50%)
NFXL1NP_001265552.1 NF-X1-zinc-finger 308..356 CDD:100116 20/57 (35%)
NF-X1-zinc-finger 361..409 CDD:100116 21/56 (38%)
NF-X1-zinc-finger 414..462 CDD:100116 17/52 (33%)
NF-X1-zinc-finger 493..541 CDD:100116 23/52 (44%)
NF-X1-zinc-finger 701..748 CDD:100116 17/49 (35%)
NF-X1-zinc-finger 765..811 CDD:100116 10/56 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1952
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.