DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stc and nfxl1

Sequence 1:NP_476599.1 Gene:stc FlyBaseID:FBgn0001978 Length:1106 Species:Drosophila melanogaster
Sequence 2:XP_012823254.1 Gene:nfxl1 XenbaseID:XB-GENE-964724 Length:913 Species:Xenopus tropicalis

Alignment Length:1041 Identity:271/1042 (26%)
Similarity:399/1042 (38%) Gaps:296/1042 (28%)


  Fly   123 PTYQNGDGIARVTVTSSYGSVNPSNSNFSSFYTPFGNNPFDFSASKLQASAPEFVPNFAKLSLEE 187
            |..|.|.|.||...||..|         .||..|   .|  .|||....|.|.            
 Frog     4 PWRQAGRGRARGRATSVNG---------GSFQAP---GP--ISASNRNTSYPR------------ 42

  Fly   188 TPAAATTNGNSTASLETAINETRPRTLRAQEPAERGANNQCSNHNYERERERERDRDRDRERDRD 252
               |..|:||..         .||.|.|..  |...|:...::.|.:||...|..:.:..|    
 Frog    43 ---AVHTDGNGA---------QRPGTGRGN--AYASASKPVTSENLKRETNEENSKKKFEE---- 89

  Fly   253 RDRDRDRDRDRDRDRDSRPGNTRQQRRSDYRDDREDRYERSDRRRPQKQQRYDNHRSNKRRDDWN 317
                                 .::..::..:....|.|..||.                      
 Frog    90 ---------------------IQKANQAAVKKLAADHYSSSDD---------------------- 111

  Fly   318 RNRDRINGFPRAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPLPPADNEKLSQREKLVRD-IEQ 381
                         :|.|...|.      ||.::..::..........|..:|::.::.:.: .:.
 Frog   112 -------------EDGDEDAEG------KQKKILALTFTSYTSQTDGDLSELARTQQYLNEAFQS 157

  Fly   382 RRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSS--------------KSEVGWRCPAC 432
            ..:.||:|:.::|.:|..|||..||.:.|:.|...||..|              |.:..|.||.|
 Frog   158 GAVTCLICIASVKRNQAVWSCSGCYCIFHMPCIQKWAKDSVFLVSSPLTDDDFDKKDYPWPCPKC 222

  Fly   433 QNVLQ--DLPRDYLCFCGKLKNPPVSRTELAHSCGEVCCR--IEGCSHACTLLCHPGPCPPCQAN 493
            :...:  :.|..|.|:|||:::||:....:.||||:||.|  ...|.|.|.|||||||||||...
 Frog   223 RYEYKRSETPSRYYCYCGKVEDPPLDPWLVPHSCGQVCEREFKPSCGHKCLLLCHPGPCPPCPKM 287

  Fly   494 VVRSCGCGRSTKTMQCAMKEEVLCGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQQCHCGKQE 558
            |..:|.|.::....:....:|..|.:.|.:.|.|.:|:|:..||.|:|..|.:...|:|.||:..
 Frog   288 VTVTCFCQKAKPVPRRCSAKEWSCQQPCRRTLMCKQHKCENPCHKGECLPCPQVSKQKCLCGRNV 352

  Fly   559 RKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPCKLSPEQITSCPCGK----MPV 619
            .:.||.     ..|:.|:..||:.||||:|.|:..||||:|..|..|..::  |||||    :| 
 Frog   353 AERPCA-----SPTWQCEKVCGKTLPCGNHTCEKICHAGACGQCPRSGNRL--CPCGKSKYTLP- 409

  Fly   620 PAGQRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSKCHLGQCPPCPKQTGVKCRCGHMDQMIKC 684
                   |.:.:|||...|.:.|.|..    |:|..:||.|.|..|.::...:||||...:.:.|
 Frog   410 -------CTEDVPTCGDSCDKLLECAL----HKCSQRCHRGPCETCRQEVEKQCRCGKHAKRMPC 463

  Fly   685 RQLCNRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTLSCGKHKCDQPCHRGNCPP 749
            .:      ...|:.:|:|.|.|.:|:|..:||......|...|.|:|.|..|||...||||:|.|
 Frog   464 HK------PYLCETKCSKVRDCQRHQCKRKCCPGNCPGCDQQCGRSLGCRNHKCPSICHRGSCYP 522

  Fly   750 CYRSSFEELYCECGAEVIYPPVPCG----TKKPICKLPCSRIHPCDHP--PQHNCHSGP------ 802
            |..:  .::.|.||..|:  .||||    ||.|.||..||....|.|.  .:|.||.||      
 Frog   523 CPET--VDVKCNCGKAVL--KVPCGRERTTKPPRCKEVCSCPPTCHHEVRERHRCHFGPCPPCRQ 583

  Fly   803 ------------------------------------------------TCPPCMIFTTKLCHGNH 819
                                                            .||||.:.....|.|.|
 Frog   584 TCQNILKKCGHLCPIPCHDEALVKQKGLPQPAGPWEQPSEPAFIQTALPCPPCQVPIPTECLGKH 648

  Fly   820 ELRKTIPCSQPN-FSCGMACGKPLPCGGHKCIKPCHE-----GPCQSAG---EICRQSCTKPRPT 875
            |: ..:||.... |||...||:.|.||.|.|.:.||:     |..:.||   .:|.:.||||||.
 Frog   649 EI-SPLPCHAAGPFSCKRPCGRLLACGNHTCSRECHKVTDVNGNKEKAGLECVVCEEECTKPRPP 712

  Fly   876 -CGHKCAAACHEGACPETPCKELVEVQCECGNRKQNRSCQELAREHSRIATIQLASSMAEMSRGN 939
             |.|:|...||...||.  |.::|..:|.|                 :|:.:             
 Frog   713 GCPHQCNLPCHPDDCPS--CVQMVRTKCHC-----------------KISNL------------- 745

  Fly   940 YMELSEI-LAPAKKSNKTLDCNDEC-RLLERNRRLAAALSSGN------SDTKQKCLTKYSEFVR 996
            ::|.::: :|.||:.|....|.::| :.|....|.......||      ...|.:|.      .|
 Frog   746 FIECTKLSMADAKEKNNLTSCKNQCPKELPCGHRCKEICHQGNCSPYCIQKVKLRCP------CR 804

  Fly   997 GFAKKNPA------------------LTKSVYETLTDLVKLAKES---KQRSRSHSFPTMNREKR 1040
            ...|:.|.                  :.|...|...:..|.|.|.   :|::...:|....:.||
 Frog   805 RIKKEMPCNSVREGHISLECDSVCLDMRKKAAEIKAEEEKAATEQERLRQQAELEAFENRLKGKR 869

  Fly  1041 Q 1041
            :
 Frog   870 R 870

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stcNP_476599.1 NF-X1-zinc-finger 464..510 CDD:100116 22/48 (46%)
NF-X1-zinc-finger 517..565 CDD:100116 17/48 (35%)
NF-X1-zinc-finger 575..617 CDD:100116 21/46 (46%)
NF-X1-zinc-finger 634..686 CDD:100116 16/52 (31%)
NF-X1-zinc-finger 723..775 CDD:100116 23/56 (41%)
NF-X1-zinc-finger 834..882 CDD:100116 23/57 (40%)
NF-X1-zinc-finger 865..915 CDD:100116 18/51 (35%)
R3H_NF-X1 996..1069 CDD:100072 12/68 (18%)
nfxl1XP_012823254.1 NF-X1-zinc-finger 311..359 CDD:100116 17/53 (32%)
NF-X1-zinc-finger 364..412 CDD:100116 23/58 (40%)
NF-X1-zinc-finger 417..465 CDD:100116 16/52 (31%)
NF-X1-zinc-finger 496..544 CDD:100116 23/52 (44%)
NF-X1-zinc-finger 702..751 CDD:100116 20/81 (25%)
NF-X1-zinc-finger 766..812 CDD:100116 11/52 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1952
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.