DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and DST1

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_011472.1 Gene:DST1 SGDID:S000003011 Length:309 Species:Saccharomyces cerevisiae

Alignment Length:322 Identity:95/323 (29%)
Similarity:155/323 (48%) Gaps:31/323 (10%)


  Fly     5 EEVFRIQKKMSKMASDGTGQDQALDLLKALQTLNINLD-ILTKTRIGMTVNELRKSSKDDEVIAL 68
            :||....|.:.|..|:...   .|::|..|....:..: :|.:|::|:.||:.:||: :.|:..|
Yeast     4 KEVLVHVKNLEKNKSNDAA---VLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKST-NVEISKL 64

  Fly    69 AKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSS--SSISGKDKSSSSSSSKDK 131
            .|.:|.:||       .....|..:::...::...:...:..|::  .|::|..:.:||.|...|
Yeast    65 VKKMISSWK-------DAINKNKRSRQAQQHHQDHAPGNAEDKTTVGESVNGVQQPASSQSDAMK 122

  Fly   132 EKKGSTSSSQTSFPSGGMTDAVRIKCREMLATAL-----KIGEVPEGCGEPEEMAAELEDAIYSE 191
            :.|..::..:.|...|..|.....|.|:.:..||     |..|      .|.:.......||.||
Yeast   123 QDKYVSTKPRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESE------HPPQSILHTAKAIESE 181

  Fly   192 F---NNTDMK---YKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLRE 250
            .   ||.|..   ||.|.|...:|:....||.|:.....|.:|.:.||....:::|...:|:..|
Yeast   182 MNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIE 246

  Fly   251 KFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGNRWKF 312
            :..|:.:.:||.||::.:.||...|.|||::..:|.||||||||||:|||..|..|||||||
Yeast   247 EIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKF 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 95/323 (29%)
TFS2N 7..82 CDD:197766 20/76 (26%)
TFIIS_M 151..257 CDD:284835 30/117 (26%)
Zn-ribbon_TFIIS 266..312 CDD:259796 27/46 (59%)
DST1NP_011472.1 TFSII 3..309 CDD:273592 95/323 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112472753
eggNOG 1 0.900 E1_COG1594
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1244
Isobase 1 0.950 0 Normalized mean entropy S1233
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T634540
orthoMCL 1 0.900 OOG5_127402
Panther 1 1.100 LDO PTHR11477
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.