DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and AT5G42325

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_680377.1 Gene:AT5G42325 AraportID:AT5G42325 Length:233 Species:Arabidopsis thaliana

Alignment Length:276 Identity:51/277 (18%)
Similarity:99/277 (36%) Gaps:89/277 (32%)


  Fly     6 EVFRIQKKMSKMASDGTGQDQALDLLKALQTL-----NINLDILTKTRIGMTVNELRKSSKDDEV 65
            |:|....:.:|.........:.|..:.|:..|     ::..|::.||.:|..:. .....|:.::
plant     8 ELFEAALRAAKSVKGAESSPEVLRFVDAMNRLKEAPKSLVCDVVCKTSMGKGLG-FFIDHKNPKI 71

  Fly    66 IALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKD 130
            .:..:.|...|.:.                                  ...||::|      |:|
plant    72 RSEGRILRDLWMKI----------------------------------HYASGREK------SRD 96

  Fly   131 KEKKGSTSSSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSEFNNT 195
            :|......:..|...:|   |:.|.|..|:|.::|            .::|.|:.|        |
plant    97 RETPVKIPTHSTMKKTG---DSKRDKVHEILQSSL------------AKVATEVVD--------T 138

  Fly   196 DMKYK--------------NRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMK 246
            :||.:              ....|.:.|:.|..||.||...:.|.::.::|.||..:||.|::::
plant   139 EMKRRVMTVCDPWVVAVSVESAMSILFNMGDSNNPDLRRKVLIGEISGERLVKMEKDEMGSEKIQ 203

  Fly   247 ------KLREKFVKEA 256
                  |.|.:|.:|:
plant   204 KEVQRIKERARFKEES 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 51/277 (18%)
TFS2N 7..82 CDD:197766 12/80 (15%)
TFIIS_M 151..257 CDD:284835 30/127 (24%)
Zn-ribbon_TFIIS 266..312 CDD:259796
AT5G42325NP_680377.1 TFIIS_I 11..85 CDD:238107 11/75 (15%)
TFIIS_M 118..208 CDD:295406 24/110 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1579101at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.