DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and AT5G25520

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001331211.1 Gene:AT5G25520 AraportID:AT5G25520 Length:1007 Species:Arabidopsis thaliana

Alignment Length:307 Identity:72/308 (23%)
Similarity:127/308 (41%) Gaps:71/308 (23%)


  Fly    12 KKMSKM--ASDGTGQDQALDLLKALQTLNINLDILTKTRIGM------TVNELRKS--SKDDEVI 66
            ||:.:|  ||..:|:                 .::.|.:.|:      |:|:..:|  ||..|.:
plant   171 KKVRQMEPASQKSGK-----------------QVMNKKQAGLSQGSVKTLNDGNESLRSKMKESL 218

  Fly    67 ALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSI--------------- 116
            |.|..|:...:.     :|....||..:|.|...:.:::..||..:|.::               
plant   219 AAALALVHEHEE-----SPKEKKNSETEEASVPVADSNEPASACGTSVTVGEDITPAMSTRDESF 278

  Fly   117 ---SGKDKSSSSSSSKDKEKK--GSTSSSQTSFPSGGMTDAVRIKCREMLATALKIG-------- 168
               :|..::.|..||||.:..  ..:...:|.|......|.||..........|..|        
plant   279 EQKNGNGRTLSQESSKDTKMNYVNQSDVQKTQFDEVFPCDDVRFSDSIFTGDELLQGNGLSWVLE 343

  Fly   169 --------EVPEGCGEPEEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCG 225
                    |..:...:||.:|:::|..::..|...:.|||.:.||.:.||||..||.||.:.|.|
plant   344 PVSDFGENETQKSFEDPELLASKIELELFKLFGGVNKKYKEKGRSLLFNLKDKNNPELRESVMSG 408

  Fly   226 AVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLATVQGTKTDL 272
            .::.::|..||.||:||.|:.:.|:...:|.   |::..::.|..|:
plant   409 KISPERLCNMTAEELASKELSQWRQAKAEEM---AEMVVLRDTDIDV 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 72/308 (23%)
TFS2N 7..82 CDD:197766 17/80 (21%)
TFIIS_M 151..257 CDD:284835 36/122 (30%)
Zn-ribbon_TFIIS 266..312 CDD:259796 2/8 (25%)
AT5G25520NP_001331211.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.