DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and TFIIS

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_181390.1 Gene:TFIIS AraportID:AT2G38560 Length:378 Species:Arabidopsis thaliana

Alignment Length:374 Identity:102/375 (27%)
Similarity:160/375 (43%) Gaps:68/375 (18%)


  Fly     6 EVFRIQKKMSKMA------SDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDE 64
            ::|...||.:..|      |.|....|.:|.||.|:...:..|.|..|::|..:..|.|...:| 
plant     7 DLFEGAKKAADAAALDGVTSSGPEVSQCIDALKQLKKFPVTYDTLVATQVGKKLRSLAKHPVED- 70

  Fly    65 VIALAKTLIKNWKRFL---ASPAPTTPNNSSAKEGSSNNSSASKSTSAA----------KSSSSI 116
            :.::|..|::.||:.:   .:.|..|...:..||...|.....|.::.|          .|:.||
plant    71 IKSVATDLLEIWKKVVIEETAKAKKTEGTNGCKEAKVNKMDVEKPSNPAPVKVQKLQRGDSAKSI 135

  Fly   117 SGKDKSSSS---------------------------SSSKDKEKKGSTSSSQTSFPSGG------ 148
            ..:.|...:                           .:.|| ||....:.|....|:..      
plant   136 KVERKEPDNKVVTGVKIERKVPDIKVTNGTKIDYRGQAVKD-EKVSKDNQSSMKAPAKAANAPPK 199

  Fly   149 ------MTDAVRIKCREMLATAL--KIGEVPE------GCGEPEEMAAELEDAIYSEFNNTDMKY 199
                  ..|.||.|.||:|..||  ..||..:      ...:|..:|..:|..::.:...:....
plant   200 LTAMLKCNDPVRDKIRELLVEALCRVAGEADDYERESVNASDPLRVAVSVESLMFEKLGRSTGAQ 264

  Fly   200 KNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLAT 264
            |.:.||.:.||:|..||.||...:.|.::.::|..::.|:||||:.|:...:..::|:.|.:...
plant   265 KLKYRSIMFNLRDSNNPDLRRRVLTGEISPEKLITLSAEDMASDKRKQENNQIKEKALFDCERGL 329

  Fly   265 VQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGNRWKFC 313
            .....||..||.:|.:|.|||.|:|||||||||||:|.|..|.|.||||
plant   330 AAKASTDQFKCGRCGQRKCTYYQMQTRSADEPMTTYVTCVNCDNHWKFC 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 101/373 (27%)
TFS2N 7..82 CDD:197766 22/84 (26%)
TFIIS_M 151..257 CDD:284835 33/114 (29%)
Zn-ribbon_TFIIS 266..312 CDD:259796 27/46 (59%)
TFIISNP_181390.1 TFSII 21..378 CDD:273592 97/359 (27%)
TFS2N 21..88 CDD:197766 18/68 (26%)
TFIIS_M 208..322 CDD:284835 33/114 (29%)
Zn-ribbon_TFIIS 332..377 CDD:259796 27/45 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1780
OMA 1 1.010
OrthoDB 1 1.010 D1579101at2759
OrthoInspector 1 1.000 T32307
orthoMCL 1 0.900 OOG5_127402
Panther 1 1.100 LDO PTHR11477
Phylome 1 0.910 0.889 Consistency score
87.980

Return to query results.
Submit another query.