DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and AT2G25640

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_180135.2 Gene:AT2G25640 AraportID:AT2G25640 Length:745 Species:Arabidopsis thaliana

Alignment Length:292 Identity:70/293 (24%)
Similarity:125/293 (43%) Gaps:53/293 (18%)


  Fly    10 IQKKM-SKMASDGTGQDQAL---DLLKALQTLNINLDILTKTRI-----------GMTVNELRKS 59
            :||.| .|..|:.:|..::.   .|..||..:...:|:..::::           |.....:..:
plant   141 LQKPMLLKPQSESSGSVRSKMRESLAGALAMVQCQMDVPNESKMLDSETVANPLEGHVSGPVSAA 205

  Fly    60 SKDDEVIALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSS--------- 115
            |..|.:::...|.:..    |:.|:|..        |.|..:...:..|.||:|.:         
plant   206 SGVDVMVSNGSTEMLT----LSDPSPVA--------GISVQTVLPEILSIAKTSDAQVPEAVKPF 258

  Fly   116 ISGKDKSSSSSSSKDKEKKGSTSS----SQTSFPSGGMTDAVRIKCR-EMLATALKIGEVPEGCG 175
            :......|.:..|||...:|:..|    |...|         .:.|: ||:......|.:.:...
plant   259 VQDNVSYSDNVFSKDDLLQGNDLSWALESDIEF---------TVNCQNEMIGAMANDGSLEKLLL 314

  Fly   176 EPEEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEM 240
            :|:.:|.|:|..::..|...:.|||.:.||.:.||||..||.||...|.|.:.|::|..|:.||:
plant   315 DPQVLAFEIETELFKLFGGVNKKYKEKGRSLLFNLKDKSNPKLREKVMYGEIAAERLCSMSAEEL 379

  Fly   241 ASDEMKKLREKFVKEAINDAQLATVQGTKTDL 272
            ||.|:.:.|:...:|.   ||:..:|.|:.|:
plant   380 ASKELAEWRQAKAEEM---AQMVVLQDTEVDI 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 70/293 (24%)
TFS2N 7..82 CDD:197766 15/87 (17%)
TFIIS_M 151..257 CDD:284835 34/107 (32%)
Zn-ribbon_TFIIS 266..312 CDD:259796 3/8 (38%)
AT2G25640NP_180135.2 TFS2M 290..390 CDD:128786 34/109 (31%)
SPOC 599..705 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.