DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and Stra6l

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_006538373.1 Gene:Stra6l MGIID:1921402 Length:700 Species:Mus musculus

Alignment Length:82 Identity:15/83 (18%)
Similarity:38/83 (46%) Gaps:4/83 (5%)


  Fly    96 GSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKDKEKKGSTSSSQTSFPSGGMTDAVRIKCREM 160
            ||.:..::.:.:|...::|::.........:..:.|::....|..:.:..:....::.||  |:.
Mouse     2 GSRHKQASEERSSPRTAASTVPRTVVLQQDACCQHKKEILGISDHRRALCARHQLESARI--RDG 64

  Fly   161 LATALKIGEVPEGCGEP 177
            .|..|::|:  ||..:|
Mouse    65 KAAGLRLGQ--EGPCQP 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 15/83 (18%)
TFS2N 7..82 CDD:197766
TFIIS_M 151..257 CDD:284835 9/28 (32%)
Zn-ribbon_TFIIS 266..312 CDD:259796
Stra6lXP_006538373.1 RBP_receptor 92..681 CDD:291422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.