Sequence 1: | NP_001260457.1 | Gene: | TfIIS / 34883 | FlyBaseID: | FBgn0010422 | Length: | 313 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081761.2 | Gene: | Med26 / 70625 | MGIID: | 1917875 | Length: | 588 | Species: | Mus musculus |
Alignment Length: | 246 | Identity: | 54/246 - (21%) |
---|---|---|---|
Similarity: | 100/246 - (40%) | Gaps: | 62/246 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 LDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSS 92
Fly 93 AK-----EGSSNN-----------SSASKSTSAAKSSSSIS----------------GKDKSSSS 125
Fly 126 SSSKDKEKKGSTS---SSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGE--PEEMAAELE 185
Fly 186 DAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGL-RGNFMCGAVTAKQLAKM 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TfIIS | NP_001260457.1 | TFSII | 5..313 | CDD:273592 | 54/246 (22%) |
TFS2N | 7..82 | CDD:197766 | 16/53 (30%) | ||
TFIIS_M | 151..257 | CDD:284835 | 21/88 (24%) | ||
Zn-ribbon_TFIIS | 266..312 | CDD:259796 | |||
Med26 | NP_081761.2 | TFS2N | 12..86 | CDD:197766 | 16/56 (29%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..393 | 33/163 (20%) | |||
Med26_M | 178..405 | CDD:292322 | 23/97 (24%) | ||
Med26_C | 407..586 | CDD:292321 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 412..441 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1594 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |