DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and Med26

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_081761.2 Gene:Med26 / 70625 MGIID:1917875 Length:588 Species:Mus musculus


Alignment Length:246 Identity:54/246 - (21%)
Similarity:100/246 - (40%) Gaps:62/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSS 92
            |:::.:|:...|..:.|.:||:|..:|::||.:|::|:...||.|:::|::.:   .|...|..:
Mouse    32 LEVISSLERYPITKEALEETRLGKLINDVRKKTKNEELAKRAKRLLRSWQKLI---EPVHQNEVA 93

  Fly    93 AK-----EGSSNN-----------SSASKSTSAAKSSSSIS----------------GKDKSSSS 125
            .:     .||:|.           :.|.||....|:.:.|.                |..:....
Mouse    94 LRALAGAAGSANGGAHNCRPEMGVAGAPKSIHDLKNRNDIQRLPGQRLDRLGSRKRRGDQRDLGH 158

  Fly   126 SSSKDKEKKGSTS---SSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGE--PEEMAAELE 185
            .....|..|||..   .:.:..|:.|::.:     .|.|.:.|      :|.|.  |:....|..
Mouse   159 PGPPHKVSKGSPDPLVPNASPLPTNGISGS-----PESLPSPL------DGSGHLGPDGSRLEPS 212

  Fly   186 DAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGL-RGNFMCGAVTAKQLAKM 235
            |   :|.::|.:.. |.:|.|      |.:||| :....|....|.||.::
Mouse   213 D---NEKHSTKIPV-NAVRPR------PSSPGLGKPPVPCLQTKAAQLQQL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 54/246 (22%)
TFS2N 7..82 CDD:197766 16/53 (30%)
TFIIS_M 151..257 CDD:284835 21/88 (24%)
Zn-ribbon_TFIIS 266..312 CDD:259796
Med26NP_081761.2 TFS2N 12..86 CDD:197766 16/56 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..393 33/163 (20%)
Med26_M 178..405 CDD:292322 23/97 (24%)
Med26_C 407..586 CDD:292321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.