| Sequence 1: | NP_001260457.1 | Gene: | TfIIS / 34883 | FlyBaseID: | FBgn0010422 | Length: | 313 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_081761.2 | Gene: | Med26 / 70625 | MGIID: | 1917875 | Length: | 588 | Species: | Mus musculus |
| Alignment Length: | 246 | Identity: | 54/246 - (21%) |
|---|---|---|---|
| Similarity: | 100/246 - (40%) | Gaps: | 62/246 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 LDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSS 92
Fly 93 AK-----EGSSNN-----------SSASKSTSAAKSSSSIS----------------GKDKSSSS 125
Fly 126 SSSKDKEKKGSTS---SSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGE--PEEMAAELE 185
Fly 186 DAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGL-RGNFMCGAVTAKQLAKM 235 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TfIIS | NP_001260457.1 | TFSII | 5..313 | CDD:273592 | 54/246 (22%) |
| TFS2N | 7..82 | CDD:197766 | 16/53 (30%) | ||
| TFIIS_M | 151..257 | CDD:284835 | 21/88 (24%) | ||
| Zn-ribbon_TFIIS | 266..312 | CDD:259796 | |||
| Med26 | NP_081761.2 | TFS2N | 12..86 | CDD:197766 | 16/56 (29%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..393 | 33/163 (20%) | |||
| Med26_M | 178..405 | CDD:292322 | 23/97 (24%) | ||
| Med26_C | 407..586 | CDD:292321 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 412..441 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1594 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||