DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and TCEA3

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_016857689.1 Gene:TCEA3 HGNCID:11615 Length:487 Species:Homo sapiens

Alignment Length:347 Identity:160/348 (46%)
Similarity:213/348 (61%) Gaps:37/348 (11%)


  Fly     1 MSVEEEVFRIQKKMSKMASDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEV 65
            |..|||:.||.||:.||.: ....:.||||||.|.:..:::.:|..||||:.||.:||...|.||
Human     1 MGQEEELLRIAKKLEKMVA-RKNTEGALDLLKKLHSCQMSIQLLQTTRIGVAVNGVRKHCSDKEV 64

  Fly    66 IALAKTLIKNWKRFLASPAPTTPNNSSAKEGSS------------------------NNSSASKS 106
            ::|||.|||||||.|.||.|........:|.:.                        .:....:.
Human    65 VSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKKREDPKTRRD 129

  Fly   107 TSAAKSSSSISGKDKS---SSSSSSKDKEKKGSTSSSQTSFPSGGMT--------DAVRIKCREM 160
            :..:|||:|.|.|..|   |:||.||.:..|..:|....:|.|....        |:||.||.||
Human   130 SVDSKSSASSSPKRPSVERSNSSKSKAESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEM 194

  Fly   161 LATALKIGEVPEGCG-EPEEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMC 224
            |:.|||..:..:..| ..::||:|:||.||.|..:|||||:||:|||::|||||:|||||.|.:.
Human   195 LSAALKADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLS 259

  Fly   225 GAVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQ 289
            ||::|..:||||.|||||||:::||....:|||.:.|:|...||.|||.:|:||||:||||||:|
Human   260 GAISAGLIAKMTAEEMASDELRELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTYNQVQ 324

  Fly   290 TRSADEPMTTFVMCNECGNRWK 311
            ||||||||||||:|||||||||
Human   325 TRSADEPMTTFVLCNECGNRWK 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 158/344 (46%)
TFS2N 7..82 CDD:197766 36/75 (48%)
TFIIS_M 151..257 CDD:284835 59/107 (55%)
Zn-ribbon_TFIIS 266..312 CDD:259796 38/47 (81%)
TCEA3XP_016857689.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112490648
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H20684
Inparanoid 1 1.050 300 1.000 Inparanoid score I2656
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T608817
orthoMCL 1 0.900 OOG5_127402
Panther 1 1.100 O PTHR11477
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.