DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and Tceanc2

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_079893.1 Gene:Tceanc2 MGIID:1913776 Length:207 Species:Mus musculus

Alignment Length:87 Identity:31/88 (35%)
Similarity:43/88 (49%) Gaps:7/88 (8%)


  Fly    29 DLLKALQTLNINL---DILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLAS--PAPTTP 88
            :|:.|||.|...:   ::|..||||..||::|:.| |.||..|||.:...||.|:..  ..|:..
Mouse    57 NLVAALQELKKKMPSREVLRSTRIGHAVNKMRRHS-DPEVAGLAKEVYTEWKTFIEKHLDRPSIE 120

  Fly    89 NNSSAKEGSSNNSSASKSTSAA 110
            ..|..|. .|...:|.|..|.|
Mouse   121 VRSDPKT-ESFRKNAQKLLSEA 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 31/88 (35%)
TFS2N 7..82 CDD:197766 23/56 (41%)
TFIIS_M 151..257 CDD:284835
Zn-ribbon_TFIIS 266..312 CDD:259796
Tceanc2NP_079893.1 TFIIS_I 38..111 CDD:238107 23/55 (42%)
TFIIS_M 128..>202 CDD:295406 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.