DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and tcea3

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001016290.1 Gene:tcea3 XenbaseID:XB-GENE-5904168 Length:292 Species:Xenopus tropicalis

Alignment Length:326 Identity:153/327 (47%)
Similarity:199/327 (61%) Gaps:56/327 (17%)


  Fly     5 EEVFRIQKKMSKM-ASDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIAL 68
            |||.||.||:.|| |...||  .|||||:.|:.:.|.|::|..||:||:||.|||.|.|:|:|.:
 Frog     6 EEVARIVKKLDKMVAKKSTG--GALDLLRELKNMAITLELLQSTRVGMSVNALRKQSNDNEIITI 68

  Fly    69 AKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDK-------SSSSS 126
            :|:|||:||:.|              :||..                 .||:|       |....
 Frog    69 SKSLIKSWKKLL--------------DGSEQ-----------------PGKEKPQTIPTCSKELG 102

  Fly   127 SSKDKE-KKGSTSSSQTSFPSGGMT-DAVRIKCREMLATALK-------IGEVPEGCGEPEEMAA 182
            |||:.| .|...:...|.||...:| |:||.||||||..||:       ||      .:.|.:||
 Frog   103 SSKNIEVPKAPITPKMTRFPPLPVTSDSVRTKCREMLRAALQTDGDHVAIG------ADCEFLAA 161

  Fly   183 ELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKK 247
            ::|:.::.|..|||||||||||||::||||.|||.||.|.:||.:..:|:|.|:.|||||:|:|:
 Frog   162 QIEEVVFGEMQNTDMKYKNRIRSRISNLKDSKNPDLRKNVLCGVIGPEQIAVMSCEEMASNELKE 226

  Fly   248 LREKFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGNRWKF 312
            :|:...|.||.:.|:|...||:|||..|.||||:||||.|:|.|||||||||||.||||||||||
 Frog   227 MRKAMTKAAIQEHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQIRSADEPMTTFVACNECGNRWKF 291

  Fly   313 C 313
            |
 Frog   292 C 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 152/325 (47%)
TFS2N 7..82 CDD:197766 39/76 (51%)
TFIIS_M 151..257 CDD:284835 56/113 (50%)
Zn-ribbon_TFIIS 266..312 CDD:259796 36/46 (78%)
tcea3NP_001016290.1 TFSII 5..292 CDD:273592 152/325 (47%)
TFIIS_I 5..81 CDD:238107 41/91 (45%)
TFIIS_M 129..236 CDD:284835 56/113 (50%)
Zn-ribbon_TFIIS 245..291 CDD:259796 36/46 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112479612
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.700

Return to query results.
Submit another query.