DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and tcea1

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_956288.1 Gene:tcea1 ZFINID:ZDB-GENE-030131-8049 Length:309 Species:Danio rerio

Alignment Length:317 Identity:166/318 (52%)
Similarity:220/318 (69%) Gaps:20/318 (6%)


  Fly     4 EEEVFRIQKKMSKMA--SDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVI 66
            |||:.||.|||.|||  .:|.|   ||||||.|:.:.:.|::|..|||||:||.:||.|.||||.
Zfish     6 EEEIIRIAKKMDKMAQKKNGVG---ALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDDEVT 67

  Fly    67 ALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKDK 131
            :|||:|||:||:.|..||....:....||.::...|.|:::...:..|       |||:||||.:
Zfish    68 SLAKSLIKSWKKLLDEPAADKNSEEKKKERTTPVVSPSETSPEPREES-------SSSNSSSKSE 125

  Fly   132 EKKGSTSSSQTSFP-SGGMTDAVRIKCREMLATALKIGE----VPEGCGEPEEMAAELEDAIYSE 191
            ....:.::...:|| :.|.:|:|||||||||:.||:.|:    :...|   :|:.|::|:.|:.|
Zfish   126 SVDVTPNTLIATFPRAPGTSDSVRIKCREMLSNALQTGDDYITIGSDC---DELGAQIEECIFLE 187

  Fly   192 FNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFVKEA 256
            |.|||||||||:|||::||||.|||.||.|.:||.|:..::||||.|||||||:|::|:...|||
Zfish   188 FKNTDMKYKNRVRSRISNLKDAKNPNLRRNVLCGNVSPDRIAKMTAEEMASDELKEMRKNLTKEA 252

  Fly   257 INDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGNRWKFC 313
            |.|.|:||..||:|||..|.||||:.|||.|:|||||||||||||.|||||||||||
Zfish   253 IRDHQVATSGGTQTDLFTCGKCKKKKCTYTQVQTRSADEPMTTFVFCNECGNRWKFC 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 164/315 (52%)
TFS2N 7..82 CDD:197766 42/77 (55%)
TFIIS_M 151..257 CDD:284835 61/110 (55%)
Zn-ribbon_TFIIS 266..312 CDD:259796 36/46 (78%)
tcea1NP_956288.1 TFIIS_I 6..82 CDD:238107 45/79 (57%)
TFSII 7..309 CDD:273592 164/315 (52%)
TFIIS_M 146..253 CDD:284835 61/110 (55%)
Zn-ribbon_TFIIS 262..308 CDD:259796 36/46 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112497443
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2511
OMA 1 1.010
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127402
Panther 1 1.100 O PTHR11477
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.940

Return to query results.
Submit another query.