DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and Med26

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001100770.2 Gene:Med26 RGDID:1309524 Length:588 Species:Rattus norvegicus

Alignment Length:228 Identity:50/229 (22%)
Similarity:94/229 (41%) Gaps:61/229 (27%)


  Fly    28 LDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSS 92
            |:::.:|:...|..:.|.:||:|..:|::||.:|::|:...||.|:::|::.:   .|...|..:
  Rat    32 LEVISSLERYPITKEALEETRLGKLINDVRKKTKNEELAKRAKRLLRSWQKLI---EPVHQNEVA 93

  Fly    93 AK-----EGSSNN-----------SSASKSTSAAKSSSSIS----------------GKDKSSSS 125
            .:     .||:|.           :.|.||....|:.:.|.                |..:....
  Rat    94 LRALAGAAGSANGGAHNCRPELGVAGAPKSIHDLKNRNDIQRLPGQRLDRLGSRKRRGDQRDLGH 158

  Fly   126 SSSKDKEKKGSTS---SSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGE--PEEMAAELE 185
            .....|..|||..   .:.:..|:.|::.:     .|.|.:.|      :|.|.  |:....||.
  Rat   159 PGPPHKVSKGSPDPLVPNASPLPTNGISGS-----PESLPSPL------DGSGHLGPDGSRLELS 212

  Fly   186 DAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGL 218
            :   :|.::|.:.. |.:|.|      |.:|||
  Rat   213 E---NEKHSTKIPV-NAVRPR------PSSPGL 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 50/229 (22%)
TFS2N 7..82 CDD:197766 16/54 (30%)
TFIIS_M 151..257 CDD:284835 17/71 (24%)
Zn-ribbon_TFIIS 266..312 CDD:259796
Med26NP_001100770.2 TFS2N 12..86 CDD:197766 16/57 (28%)
Med26_M 178..405 CDD:292322 19/80 (24%)
Med26_C 407..586 CDD:292321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.