DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and Tcea3

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001015008.1 Gene:Tcea3 RGDID:1311369 Length:348 Species:Rattus norvegicus

Alignment Length:358 Identity:165/359 (46%)
Similarity:222/359 (62%) Gaps:55/359 (15%)


  Fly     1 MSVEEEVFRIQKKMSKMA----SDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSK 61
            |.:|||:.||.||:.||.    ::|     ||||||.|.:..:::.:|..||||:.||.:||...
  Rat     1 MGLEEELLRIAKKLEKMVARKKTEG-----ALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCS 60

  Fly    62 DDEVIALAKTLIKNWKRFLASPAPTTPNNSSAKE---------GSS------------------- 98
            |.||::|||.|||||||.|.||. ||.....|:|         |||                   
  Rat    61 DKEVVSLAKVLIKNWKRLLDSPR-TTKGEREAREKAKKKEKGLGSSGWKPEAGLSPPRKKEGGEP 124

  Fly    99 -----NNSSASKSTSAAKSSSSISGKDKSSSSSSSKDKEKKGSTSSSQTSFPSGGMT-------D 151
                 :..|.|.:||:.|..|    .::|:||.|..:..|..|:.|:.|..|:..:.       |
  Rat   125 KTRRDSVDSRSSTTSSPKRPS----LERSNSSRSKVETPKTPSSPSTPTFAPAVCLLASCYLTGD 185

  Fly   152 AVRIKCREMLATALKIGEVPEGCG-EPEEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKN 215
            :||.||.|||:.|||..:..:..| ..:::|:|:||.||.|..:|||||:||:|||::|||||:|
  Rat   186 SVRDKCVEMLSAALKAEDDFKDYGVNCDKLASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRN 250

  Fly   216 PGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLATVQGTKTDLLKCAKCKK 280
            ||||.|.:.|.::.:.:||||.|||||||:::||....:|||.:.|:|...||.||||:|:||||
  Rat   251 PGLRRNVLSGTISPELIAKMTAEEMASDELRELRNAMTQEAIREHQMAKTGGTTTDLLRCSKCKK 315

  Fly   281 RNCTYNQLQTRSADEPMTTFVMCNECGNRWKFC 313
            :||||||:|||||||||||||:|||||||||||
  Rat   316 KNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 162/353 (46%)
TFS2N 7..82 CDD:197766 37/79 (47%)
TFIIS_M 151..257 CDD:284835 56/107 (52%)
Zn-ribbon_TFIIS 266..312 CDD:259796 39/46 (85%)
Tcea3NP_001015008.1 TFIIS_I 4..80 CDD:238107 40/81 (49%)
TFSII 5..348 CDD:273592 162/353 (46%)
TFIIS_M 185..292 CDD:284835 56/107 (52%)
Zn-ribbon_TFIIS 301..347 CDD:259796 39/46 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112490763
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H20684
Inparanoid 1 1.050 306 1.000 Inparanoid score I2506
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T617756
orthoMCL 1 0.900 OOG5_127402
Panther 1 1.100 O PTHR11477
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.