DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and Tcea2

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_006235802.1 Gene:Tcea2 RGDID:61825 Length:318 Species:Rattus norvegicus

Alignment Length:302 Identity:148/303 (49%)
Similarity:199/303 (66%) Gaps:32/303 (11%)


  Fly    24 QDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTP 88
            |:.|:|||:.|:.:.|.|.:|..||:||:||.|||.|.|:|:|||||:|||:||:.|        
  Rat    37 QEGAMDLLRELKNMPITLHLLQSTRVGMSVNALRKQSSDEELIALAKSLIKSWKKLL-------- 93

  Fly    89 NNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSS-------SSSSKDKEKKGSTSSSQTSFPS 146
               ...:|.|.:.  .:.|....|||    ||.|.:       ||..|....:.|::...|:||.
  Rat    94 ---DVSDGKSRDQ--GRGTPLPTSSS----KDASGTTDLRLCLSSCKKPDPPRTSSTPRITTFPQ 149

  Fly   147 GGMT-DAVRIKCREMLATALKIGE----VPEGCGEPEEMAAELEDAIYSEFNNTDMKYKNRIRSR 206
            ..:| ||||.||||||..||:...    |...|   |.:::::|:.|:.:..|||||||||:|||
  Rat   150 VPITCDAVRNKCREMLTLALQTDHDHVAVGVSC---EHLSSQIEECIFLDVGNTDMKYKNRVRSR 211

  Fly   207 VANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLATVQGTKTD 271
            ::||||.||||||.|.:|||:|.:|:|.||.|||||||:|::|:...||||.:.|:|...||:||
  Rat   212 ISNLKDAKNPGLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTD 276

  Fly   272 LLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGNRWKFC 313
            |..|.||:|:||||.|:||||:||||||:|:|||||||||||
  Rat   277 LFTCNKCRKKNCTYTQVQTRSSDEPMTTYVVCNECGNRWKFC 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 147/301 (49%)
TFS2N 7..82 CDD:197766 32/58 (55%)
TFIIS_M 151..257 CDD:284835 60/110 (55%)
Zn-ribbon_TFIIS 266..312 CDD:259796 34/46 (74%)
Tcea2XP_006235802.1 TFSII 35..318 CDD:273592 147/301 (49%)
TFIIS_I <35..94 CDD:238107 32/68 (47%)
TFIIS_M 155..262 CDD:284835 60/110 (55%)
Zn-ribbon_TFIIS 271..317 CDD:259796 34/46 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112480273
eggNOG 1 0.900 E1_COG1594
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 306 1.000 Inparanoid score I2506
OMA 1 1.010
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T617756
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11477
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.