DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and tfs1

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_593623.1 Gene:tfs1 PomBaseID:SPAC20H4.03c Length:293 Species:Schizosaccharomyces pombe

Alignment Length:305 Identity:98/306 (32%)
Similarity:149/306 (49%) Gaps:47/306 (15%)


  Fly    30 LLKALQTLNINL----------------DILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKR 78
            |.||:|..||..                ::|.:||:|:.|.:|| |..:::|...|:.::|.||.
pombe    13 LEKAIQGKNIETIINIMTRLKNEVVATEELLKETRLGLVVGKLR-SHPNEKVGEQAREIVKKWKA 76

  Fly    79 FLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKDKEKKGSTSSSQTS 143
            .::...|.                  |:|:...|:.|     |.:...|...|:.:..:||.|.:
pombe    77 DVSKGRPL------------------KTTTTTSSTPS-----KHADVGSQAQKQVQKQSSSGQRT 118

  Fly   144 FPSGGMT-----DAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSE-FNNTDMKYKNR 202
            |.|..:.     |.:|..|..::..||.| :..|........|.|::..:.:. ...|..:|:||
pombe   119 FKSDNVNVNVTDDKIRNNCIGLMYNALVI-DSDESSSLIIAKAKEIDAQVLARAAGKTGSEYRNR 182

  Fly   203 IRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLATVQG 267
            :||...||||..||.||.:.:...:|.::|:.||..|:||::.:|...|..:|.:..||.|..|.
pombe   183 MRSLYMNLKDKNNPKLRASVLRNEITPQRLSTMTSAELASEDRRKEDAKLEQENLFHAQGAKPQK 247

  Fly   268 TKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGNRWKF 312
            ..|||..|.|||::..:|.|:||||||||||||..|..|||||||
pombe   248 AVTDLFTCGKCKQKKVSYYQMQTRSADEPMTTFCECTVCGNRWKF 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 98/306 (32%)
TFS2N 7..82 CDD:197766 19/68 (28%)
TFIIS_M 151..257 CDD:284835 33/107 (31%)
Zn-ribbon_TFIIS 266..312 CDD:259796 29/46 (63%)
tfs1NP_593623.1 TFSII 3..293 CDD:273592 98/306 (32%)
TFIIS_I 3..78 CDD:238107 19/66 (29%)
TFIIS_M 131..237 CDD:284835 33/107 (31%)
Zn-ribbon_TFIIS 246..292 CDD:259796 29/46 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I1349
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T631458
orthoMCL 1 0.900 OOG5_127402
Panther 1 1.100 LDO PTHR11477
Phylome 1 0.910 0.868 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.