DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and Tcea3

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_006538773.1 Gene:Tcea3 MGIID:1196908 Length:385 Species:Mus musculus

Alignment Length:388 Identity:160/389 (41%)
Similarity:220/389 (57%) Gaps:78/389 (20%)


  Fly     1 MSVEEEVFRIQKKMSKMA-------------SDGTGQDQALDLLKALQTLNINLDILTKTRIGMT 52
            |.:|||:.||.||:.||.             |....::.||||||.|.:..:::.:|..||||:.
Mouse     1 MGLEEELLRIAKKLEKMVSRKKTVRLQSLQRSPRATEEGALDLLKKLNSCQMSIQLLQTTRIGVA 65

  Fly    53 VNELRKSSKDDEVIALAKTLIKNWKRF----------------------LASPAPTTPN------ 89
            ||.:||...|.||::|||.|||||||.                      |||.:|.|..      
Mouse    66 VNGVRKHCSDKEVVSLAKVLIKNWKRLLGERGQDRWEMGLPASMWERPCLASDSPRTTKGEREER 130

  Fly    90 --------------------NSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKDKEKK 134
                                :...|:|.....:...|..:..|::|...:.....|:|||.|.:.
Mouse   131 EKAKKEKGLGCSDWKPEAGLSPPRKKGGGEPKTRRDSVDSRSSTTSSPKRPSLERSNSSKSKVET 195

  Fly   135 GSTSSSQTS-------------FPSGGMTDAVRIKCREMLATALKIGEVPEGCG-EPEEMAAELE 185
            .:|.||.::             :.:|   |:||.||.|||:.|||..:..:..| ..:::|:|:|
Mouse   196 PTTPSSPSTPTFAPAVCLLAPCYLTG---DSVRDKCVEMLSAALKAEDNFKDYGVNCDKLASEIE 257

  Fly   186 DAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLRE 250
            |.||.|..:|||||:||:|||::|||||:|||||.|.:.||::.:.:||||.|||||||:::||.
Mouse   258 DHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISPELIAKMTAEEMASDELRELRN 322

  Fly   251 KFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGNRWKFC 313
            ...:|||.:.|:|...||.||||:|:||||:||||||:|||||||||||||:|||||||||||
Mouse   323 AMTQEAIREHQMAKTGGTTTDLLRCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 157/383 (41%)
TFS2N 7..82 CDD:197766 38/110 (35%)
TFIIS_M 151..257 CDD:284835 57/107 (53%)
Zn-ribbon_TFIIS 266..312 CDD:259796 39/46 (85%)
Tcea3XP_006538773.1 TFIIS_I 4..93 CDD:238107 39/89 (44%)
TFSII 5..385 CDD:273592 157/383 (41%)
TFS2M 222..323 CDD:128786 55/101 (54%)
Zn-ribbon_TFIIS 338..384 CDD:259796 39/46 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112490358
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H20684
Inparanoid 1 1.050 305 1.000 Inparanoid score I2602
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T615643
orthoMCL 1 0.900 OOG5_127402
Panther 1 1.100 O PTHR11477
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.