DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and Tcea2

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_033352.1 Gene:Tcea2 MGIID:107368 Length:299 Species:Mus musculus

Alignment Length:320 Identity:156/321 (49%)
Similarity:210/321 (65%) Gaps:28/321 (9%)


  Fly     1 MSVEEEVFRIQKKMSKMASDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEV 65
            |..|||:.||.:::.||.:....:. |:|||:.|:.:.|.|.:|..||:||:||.|||.|.|:|:
Mouse     1 MGKEEEIARIARRLDKMVTRKNAEG-AMDLLRELKNMPITLHLLQSTRVGMSVNALRKQSSDEEL 64

  Fly    66 IALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKD 130
            |||||:|||:||:.|           ...:|.|.|.  .:.|....|||    ||.|.::..|..
Mouse    65 IALAKSLIKSWKKLL-----------DVSDGKSRNQ--GRGTPLPTSSS----KDASRTTDLSCK 112

  Fly   131 KEKKGSTSSSQ--TSFPSGGMT-DAVRIKCREMLATALKIGE----VPEGCGEPEEMAAELEDAI 188
            |.....|.|:.  |:||...:| ||||.||||||..||:...    |...|   |.:::::|:.|
Mouse   113 KPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLALQTDHDHVAVGVNC---EHLSSQIEECI 174

  Fly   189 YSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFV 253
            :.:..|||||||||:|||::||||.||||||.|.:|||:|.:|:|.||.|||||||:|::|:...
Mouse   175 FLDVGNTDMKYKNRVRSRISNLKDAKNPGLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMT 239

  Fly   254 KEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGNRWKFC 313
            ||||.:.|:|...||:|||..|.||:|:||||.|:||||:||||||:|:|||||||||||
Mouse   240 KEAIREHQMARTGGTQTDLFTCNKCRKKNCTYTQVQTRSSDEPMTTYVVCNECGNRWKFC 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 153/315 (49%)
TFS2N 7..82 CDD:197766 35/75 (47%)
TFIIS_M 151..257 CDD:284835 60/110 (55%)
Zn-ribbon_TFIIS 266..312 CDD:259796 34/46 (74%)
Tcea2NP_033352.1 TFIIS_I 4..80 CDD:238107 38/88 (43%)
TFSII 5..299 CDD:273592 153/315 (49%)
DUF4584 87..>148 CDD:291876 26/67 (39%)
TFIIS_M 136..243 CDD:284835 60/110 (55%)
Zn-ribbon_TFIIS 252..298 CDD:259796 34/46 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112479884
eggNOG 1 0.900 E1_COG1594
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 305 1.000 Inparanoid score I2602
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T615643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11477
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 1 0.960
1211.900

Return to query results.
Submit another query.