DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and mdt-26

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_740996.2 Gene:mdt-26 WormBaseID:WBGene00016115 Length:561 Species:Caenorhabditis elegans

Alignment Length:334 Identity:73/335 (22%)
Similarity:121/335 (36%) Gaps:106/335 (32%)


  Fly     5 EEVFRIQKKMSKMASDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKS--SKDDEVIA 67
            ||:    ||..::|::...|.....||..::.|..:.:||.:||||..||:||:.  .|...::.
 Worm    28 EEI----KKRLQIAAENDDQTLCESLLNEVRPLVTSREILEETRIGFVVNQLRRQYFKKWPALLR 88

  Fly    68 LAKTLIKNWKRFL----------ASPAPTTPN------------------------NSSAKEGS- 97
            :::.:||:|...:          ||...||||                        .|:...|| 
 Worm    89 ISREVIKSWSEIVCDEVKRPQSGASSRNTTPNVLSPSVARLMQRGITPNTPAGRRVTSTGLPGSQ 153

  Fly    98 ------SNNSSASKS------TSAAKSSSSISGKDKSSSSSSSKDKEKKGSTSSSQTSFPSGGMT 150
                  :|.|.|.:|      ::...:|..::|..||:|......|....|.|:...:....|..
 Worm   154 QRLVSPANGSYAPRSQVSPGESTPVAASVVVNGMHKSASVGGDLLKHATASLSTKPITPKENGKR 218

  Fly   151 DAV------RIKCREMLATALKIGEVPEGCGEPEEMA----------------------AELEDA 187
            .||      .||..:..|.||.:...|   |.|..||                      |::...
 Worm   219 KAVDEAAAPSIKRTKTAAAALSVSITP---GTPTTMAPQTPTMSVSAARKAVQSTSELFAQMSQT 280

  Fly   188 IYSEFN-NTDMK-YKNRIRSRVANLKDP------KNPGLRGNFMCGAVTAKQLAKM--------- 235
            :....: .||:: ::.|::   ..|||.      ::....|||.....|.::..|.         
 Worm   281 LPGHIDIGTDIREHEERVK---RELKDEELAHSLQSSASYGNFGSATTTERKKRKYERKIQKGTA 342

  Fly   236 --TPEEMAS 242
              ||..:||
 Worm   343 PGTPAAVAS 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 73/335 (22%)
TFS2N 7..82 CDD:197766 22/87 (25%)
TFIIS_M 151..257 CDD:284835 28/140 (20%)
Zn-ribbon_TFIIS 266..312 CDD:259796
mdt-26NP_740996.2 TFIIS_I 30..102 CDD:294098 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.