DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TfIIS and TCEANC2

DIOPT Version :9

Sequence 1:	NP_001260457.1	Gene:	TfIIS / 34883	FlyBaseID:	FBgn0010422	Length:	313	Species:	Drosophila melanogaster
Sequence 2:	NP_694580.1	Gene:	TCEANC2 / 127428	HGNCID:	26494	Length:	208	Species:	Homo sapiens

Alignment Length:	135	Identity:	41/135 - (30%)
Similarity:	54/135 - (40%)	Gaps:	35/135 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 RIQKKMSKMASDGTGQDQAL----------------------------DLLKALQTLNINL---D 42
            |||....|..|.|....||.                            :|::|||.|...:   :
Human    10 RIQNSPQKKDSGGKVYKQATIESLKRVVVVEDIKRWKTMLELPDQTKENLVEALQELKKKIPSRE 74

  Fly    43 ILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLA--SPAPTTPNNSSAKEGSSNNSSASK 105
            :|..||||.|||::||.| |.||.:||:.:...||.|..  |..|:....|..|. .|...:|.|
Human    75 VLKSTRIGHTVNKMRKHS-DSEVASLAREVYTEWKTFTEKHSNRPSIEVRSDPKT-ESLRKNAQK 137

  Fly   106 STSAA 110
            ..|.|
Human   138 LLSEA 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TfIIS	NP_001260457.1	TFSII	5..313	CDD:273592	41/135 (30%)
		TFS2N	7..82	CDD:197766	32/105 (30%)
		TFIIS_M	151..257	CDD:284835
		Zn-ribbon_TFIIS	266..312	CDD:259796
TCEANC2	NP_694580.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..21		4/10 (40%)
		TFIIS_I	40..110	CDD:238107	23/70 (33%)
		TFIIS_M	129..>203	CDD:311443	5/14 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1594
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810