DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and tceanc

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001120586.1 Gene:tceanc XenbaseID:XB-GENE-942644 Length:349 Species:Xenopus tropicalis

Alignment Length:343 Identity:98/344 (28%)
Similarity:154/344 (45%) Gaps:42/344 (12%)


  Fly     3 VEEEVFRIQKKMSKMASDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIA 67
            :.:|:.....::..:.::...:|.|.. |...:...:...||..|.|...|..:.|:.....:..
 Frog     6 INKELVSRALEVENLLAERKYEDLAFH-LTYFEKAEVTSGILQGTDIVRVVYRVLKTCPRGALKL 69

  Fly    68 LAKTLIKNWKRFLASPAPTTPNNSSAKEGSS----NNSSASKSTSAAKSSSSISGK----DKSSS 124
            .||.|:..||:........|   |...|..|    |.....|.....:.....|.:    :||:|
 Frog    70 KAKVLLSKWKKLYRKCCHET---SCICEHCSKICENKEGPEKLAVDIQDQVHNSEQKILINKSTS 131

  Fly   125 SSSSKDKEKKGSTSSSQTSFPS--GGMTD------------AVRIKCREMLATALKIGEVPEGCG 175
            |.||.......|.||:|..:.:  ..:||            |:|.||.|:|..||:  |..| |.
 Frog   132 SPSSYKFNLNKSDSSAQDCYGNHEESVTDHEVPKKVNAEDLALRTKCTELLYQALR--EDSE-CQ 193

  Fly   176 EP-EEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEE 239
            |. :.:|..:|:.||........||:|.|||:::|||:|||..|:...:..|::.|..|:|...|
 Frog   194 EKLQNLAKAIEENIYKIHAGNTKKYRNCIRSKISNLKNPKNSHLKMQILSRALSPKVFAEMGVME 258

  Fly   240 MASDEMKKLREKFVKEAINDAQLAT-VQGTKTDLLKCAKCKKRNCTYNQL-----------QTRS 292
            ||.||::.||..:.:..:.:.||.. |.|..|:.::|.:|.|.|||...:           :|.:
 Frog   259 MACDELRNLRANYTETCVQEHQLPQGVDGVHTNKIRCRRCDKFNCTVTMISRGTLFLPGWVRTGN 323

  Fly   293 ADEPMTTFVMCNECGNRW 310
            .||.|.|||:|||||.:|
 Frog   324 PDEEMMTFVICNECGEQW 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 98/342 (29%)
TFS2N 7..82 CDD:197766 14/75 (19%)
TFIIS_M 151..257 CDD:284835 41/119 (34%)
Zn-ribbon_TFIIS 266..312 CDD:259796 21/57 (37%)
tceancNP_001120586.1 Med26 32..81 CDD:285873 12/50 (24%)
TFIIS_M 173..273 CDD:284835 40/103 (39%)
Zn-ribbon 290..341 CDD:295390 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112505557
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.