DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIS and tceanc2

Sequence 1:NP_001260457.1 Gene:TfIIS FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001120119.1 Gene:tceanc2 XenbaseID:XB-GENE-6258840 Length:207 Species:Xenopus tropicalis

Alignment Length:210 Identity:39/211 (18%)
Similarity:71/211 (34%) Gaps:67/211 (32%)


  Fly    29 DLLKALQTLNINL---DILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNN 90
            :||:||..|...:   :::..|:||..|..|. :..|.||..||:.:...|:.|:          
 Frog    57 NLLEALMELKKKIPSEEVILSTKIGEAVRNLH-THNDKEVAGLAQEIHTQWETFI---------- 110

  Fly    91 SSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKDKEKKGSTSSSQTSFPSGGMTDAVRI 155
                                                    ||.:   ........|..:|:.:|.
 Frog   111 ----------------------------------------KEYR---CKPCIEVRSDAVTEKLRG 132

  Fly   156 KCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSEFNN-TDMKYKNRIRSRVANLKDPKNPGLR 219
            ..|.:|..||:       ..:...:|..:|..|:.|... .::.|:..:|:.|..||  ..|.:|
 Frog   133 NARRLLCEALQ-------TADDNSLAECIEREIFHESKRLINVPYRRTVRTLVFALK--HKPEIR 188

  Fly   220 GNFMCGAVTAKQLAK 234
            .....|::...:|.:
 Frog   189 SQVKNGSIPLNELVR 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 39/211 (18%)
TFS2N 7..82 CDD:197766 17/56 (30%)
TFIIS_M 151..257 CDD:284835 18/86 (21%)
Zn-ribbon_TFIIS 266..312 CDD:259796
tceanc2NP_001120119.1 TFIIS_I 39..110 CDD:294098 17/54 (31%)
TFIIS_M 128..>204 CDD:284835 18/86 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.