DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ck and Myo7a

Sequence 1:NP_001285949.1 Gene:ck FlyBaseID:FBgn0000317 Length:2167 Species:Drosophila melanogaster
Sequence 2:XP_006229804.1 Gene:Myo7a RGDID:628830 Length:2276 Species:Rattus norvegicus

Alignment Length:2225 Identity:1364/2226 (61%)
Similarity:1705/2226 (77%) Gaps:81/2226 (4%)


  Fly     6 RGDYIWIEPASGREFDVAIGARVVSAEGRRIQVRDDDGDEVWLAPER--RIKAMHASSVQGVEDM 68
            :|||:|::..||:||||.|||.|...|..:|||.||:|:|.|::|:.  .||.||.:||.|||||
  Rat    67 KGDYVWMDLKSGQEFDVPIGAMVKLCESGQIQVVDDEGNEHWISPQNATHIKPMHPTSVHGVEDM 131

  Fly    69 ISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIF 133
            |.||||:||||||||||||:::|||||||||||||||||:|.||:.:.|:.|..:||||:|||||
  Rat   132 IRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSSEHIRQYTNKKIGEMPPHIF 196

  Fly   134 AIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFG 198
            ||.||.|.:|||..:|||.:||||||||||||||||||:||||||:|||||||:|||.|||||||
  Rat   197 AIADNCYFNMKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFG 261

  Fly   199 NAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSAD 263
            |||||||||||||||||||||:..|.|||||||||||||||:..|...|||||||||:|.|::.:
  Rat   262 NAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLEGMNEE 326

  Fly   264 EKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGN 328
            ||.:|.||.||||.||..||.||||||.|:.|:::||||||||:|:|.|.|||:|||||:||.||
  Rat   327 EKKKLGLGQAADYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEILKLLAAILHMGN 391

  Fly   329 IKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVR 393
            ::|:|...:||||.|:....::...|..|.:....|:..||.|||...||||.:.|||:|::|||
  Rat   392 LQYEARTFENLDACEVLFSPSLATAASHLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVR 456

  Fly   394 DAFVKGIYGRMFVHIVRKINTAIFKPRG----TSRNAIGVLDIFGFENFDQNSFEQFCINYANEN 454
            ||||||||||:||.||.|||.||:||..    .||.:||:|||||||||..|||||.|||:|||:
  Rat   457 DAFVKGIYGRLFVWIVEKINAAIYKPPSQEVTNSRRSIGLLDIFGFENFTVNSFEQLCINFANEH 521

  Fly   455 LQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTML 519
            ||||||:|:||||||||:.|:|:|.||||.|||:|||:||.:.:|:::|||||::||||||.|||
  Rat   522 LQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQEALDMIANRPMNVISLIDEESKFPKGTDATML 586

  Fly   520 AKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSTNKFLR 584
            .||:..|..:.||:.||:...|.||:|||||:|:|:::|||:|||||...|::.||..|.|||::
  Rat   587 HKLNSQHRLNANYVPPKNSHETQFGINHFAGIVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFVK 651

  Fly   585 QIFAQDIEMGAETRKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQ 649
            |||..|:.||||||||:||||:||::||:.||:||.:|||||:|||||||.||||:|||.||.||
  Rat   652 QIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQ 716

  Fly   650 LRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPGVPPAHR-TDCQAATSRICAVVLG-KSDYQ 712
            |||||||||||||.||||||:.|.|||||||.|:|||.||:: .|.|....|:...||| ..|:|
  Rat   717 LRYSGMMETIRIRHAGYPIRYSFVEFVERYRVLLPGVKPAYKQDDLQGTCQRMAEAVLGTHDDWQ 781

  Fly   713 LGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRK 777
            :|.||:||||.||:.||.|||:.:|.::::||:.|||:..|..||||::||..:||.|:|:..||
  Rat   782 IGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLRLKSAATLIQRHWRGHHCRK 846

  Fly   778 RYRNMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAHARGYLVRREYGHKMWAVIKIQSHVRRM 842
            .|..:|:|::|||||.|||.|..::|..|..|:..||..|.|||||.:.|::||||.:|::.|.|
  Rat   847 NYELIRLGFLRLQALHRSRKLHKQYRLARQRIIKFQARCRAYLVRRAFRHRLWAVITVQAYARGM 911

  Fly   843 IAMRRYRKLRLEHKQFAEVLQLRKLEEQEL-LHRGNKHAREIAEQHYRDRLHELER----REIQE 902
            ||.|.:|:||:|:.:..|..::|..||::| .....|.|:|.||:.:::||.:|.|    ||::|
  Rat   912 IARRLHRRLRVEYWRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLAREDAERELKE 976

  Fly   903 QLENRRRVEVNMNIINDAARKQEEPVDDGKLVEAMFDFLPDSSSDAPTPHGGRETSVFNDLPHA- 966
            :.|.||:.|    ::....|.:.||::...:|:.||.|| .:||..|... |:..|.|.||... 
  Rat   977 KEEARRKKE----LLQQMERARHEPINHSDMVDKMFGFL-GTSSGLPGQE-GQAPSGFEDLERGR 1035

  Fly   967 QNVNQDDIIAPIHI-SEDEEDLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPLHTQGDQLAAQ 1030
            :.:.::|:.|.:.: .||||||||:||.|||||||||...|.|.::.||.|||....:||||||.
  Rat  1036 REMVEEDVDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAAL 1100

  Fly  1031 ALWITILRFTGDMPEPKYHT--MDRMDTTSVMSKVTATLGRNFIRSKEFQEAQLMGLDPDAFLK- 1092
            |:|||||||.||:|||||||  .|..:...||:|:..|||:...: :|.|..|..|   :|.|. 
  Rat  1101 AVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYK-RELQALQGEG---EAQLSE 1161

  Fly  1093 -QKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDDEYTADSYQSWLQSRPTSNLEKLHFIIGHGILR 1156
             ||..|::||||.||||:|:||.|:|.:||.|.|..... .|.|:.||||||||||||||:||||
  Rat  1162 GQKKTSVKHKLVHLTLKKKSKLTEEVTKRLHDGESMVQG-NSMLEDRPTSNLEKLHFIIGNGILR 1225

  Fly  1157 AELRDEIYCQICKQLTNNPLKSSHARGWILLSLCVGCFAPSEKFVNYLRAFIREGPPGYAPYCEE 1221
            ..|||||||||.||||:||.|||:||||||:||||||||||||||.|||.||..|||||||||||
  Rat  1226 PALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEE 1290

  Fly  1222 RLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLK 1286
            ||:|||.||||.||||||||||||||||||||:|||||.||||||||||||:||||.|:||||||
  Rat  1291 RLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLADSATTAKELCNALADKISLK 1355

  Fly  1287 DQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHEPTH 1351
            |:|||||||||||||||||||.|||||||||||||||||||||||||||||||||:|.|||.|:.
  Rat  1356 DRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSE 1420

  Fly  1352 DQVATNLIYQQVVRGVKFGEYRCDKEEDLAMIAAQQYFIEYSTDMSMERLFTLLPNFIPDFCLSG 1416
            |.|||||||||||||||||||||:||:|||.:|:||||::|.::|.:|||.:|:|.:|||..::.
  Rat  1421 DNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITP 1485

  Fly  1417 VDKAIERWAALVLQAYKKSYYVKDKIAPLKIKEDIVSYAKYKWPLLFSRFYEAYRNSGPNLPKND 1481
            : |.:|:||.|.:.|:||..|.:.:....|:|:|:|:||::|||||||||||||:.|||.|||:|
  Rat  1486 L-KNLEKWAQLAIAAHKKGIYAQRRTDAQKVKQDVVNYARFKWPLLFSRFYEAYKFSGPPLPKSD 1549

  Fly  1482 VIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSQKT----------------------------- 1517
            ||:||||||||.||:|||||||||||||.||||.:.                             
  Rat  1550 VIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSRECRVLLSLGCSDLGCASCHSGRAGLTPAGP 1614

  Fly  1518 ---------NKVFTQTFSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKKRSKYVIALQDYRAPS 1573
                     .|:...:|:|:|::|:|:||.|.||||||||||.||:||:||||||:||||...|:
  Rat  1615 CSPCWSCRGAKLMAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPA 1679

  Fly  1574 -DGTSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAETVYVLPTLSKPPQDILA 1637
             :.:.||||.||||||| |...||.|:|:||..|..:|:::|||||.:.|||:||::.||::|:|
  Rat  1680 GEESGFLSFAKGDLIIL-DHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVA 1743

  Fly  1638 LFNI---EEAHHGRRLSMASNGGAVEP--RDRPHTLMEYALDHFRLPPKRTMSKTLTLSSKRSEE 1697
            |..:   :.....|.|.:.:    .||  |.:|:||.|::.|:||.|||.|:|:.:...::..:.
  Rat  1744 LVTMTPDQRQDVVRLLQLRT----AEPEVRTKPYTLEEFSYDYFRSPPKHTLSRVMVSKARGKDR 1804

  Fly  1698 LWRYSRDPIKAPLLRKLQSKEEFAEEACFAFAAILKYMGDLPSKRPRMGNEITDHIFDGPLKHEI 1762
            ||.::|:|:|..||:|:...||.::|||.:|.|:||||||.||||.|..||:||.||:..:|.|.
  Rat  1805 LWSHTREPLKQALLKKIVGSEELSQEACMSFIAVLKYMGDYPSKRTRSVNELTDQIFEWAVKAEP 1869

  Fly  1763 LRDEIYCQLMKQLTDNRNRMSEERGWELMWLATGLFACSQGLLKELLLFLRTRRH-PISQDSMHR 1826
            |:||.|.|::||||||..|.|||:||||:||.||||..|..||..:..||::|:| |::.|.:.|
  Rat  1870 LKDEAYVQILKQLTDNHIRYSEEKGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQR 1934

  Fly  1827 LQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLR 1891
            |||.:|:|.||||||.|||||||||||||||||||||||||||||:|||:|||||.||:.||.|:
  Rat  1935 LQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIASRLLLK 1999

  Fly  1892 TSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVP 1956
            :|||||||||||||||||||.||||||||||||||||||||:||..|..||||||||||||.|||
  Rat  2000 SSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVP 2064

  Fly  1957 GKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDI 2021
            |||..||.||||:|||||.|||||||:|||..:|.||::||:|.|:|....:||::||||:|.|:
  Rat  2065 GKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDL 2129

  Fly  2022 MKIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAI 2086
            ::..|..:|||||||.:|:..|.:.|:||:||||::::||||||||||||||||||:||:|||||
  Rat  2130 IRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAI 2194

  Fly  2087 NKHGVSLIHPVTKDILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYI 2151
            ||:|:|||.|.|||||.|||||:||||||||||||:|||||||||||||||||||||||||||||
  Rat  2195 NKYGISLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYI 2259

  Fly  2152 SLMLTNMNKNRTIRA 2166
            |.|||.|:|.|..|:
  Rat  2260 SQMLTAMSKQRNSRS 2274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ckNP_001285949.1 MYSc 64..733 CDD:214580 447/675 (66%)
MYSc_Myo7 77..721 CDD:276832 428/650 (66%)
MyTH4 <1138..1245 CDD:214535 92/107 (86%)
B41 1251..1467 CDD:214604 155/216 (72%)
FERM_B-lobe 1355..1439 CDD:271216 49/84 (58%)
FERM_C1_MyoVII 1461..1559 CDD:270019 70/136 (51%)
SH3 1560..1624 CDD:302595 36/65 (55%)
MyTH4 1701..1849 CDD:214535 84/149 (56%)
B41 1856..2068 CDD:214604 151/212 (71%)
FERM_M 1966..2068 CDD:278785 59/102 (58%)
FERM_C2_MyoVII 2064..2159 CDD:270020 84/95 (88%)
Myo7aXP_006229804.1 MYSc 121..802 CDD:214580 450/681 (66%)
MYSc_Myo7 140..790 CDD:276832 428/650 (66%)
IQ 827..848 CDD:197470 10/21 (48%)
MAP7 <918..996 CDD:283355 26/82 (32%)
eIF3_subunit 936..>991 CDD:285763 19/59 (32%)
MyTH4 1078..1314 CDD:214535 156/241 (65%)
B41 1320..1535 CDD:214604 155/216 (72%)
FERM_N 1323..>1362 CDD:286467 33/39 (85%)
FERM_B-lobe 1424..1524 CDD:271216 55/101 (54%)
FERM_C1_MyoVII 1529..1665 CDD:270019 70/136 (51%)
SH3_MYO7A 1666..1730 CDD:212814 36/65 (55%)
MyTH4 1808..1957 CDD:214535 84/149 (56%)
B41 1964..2176 CDD:214604 151/212 (71%)
FERM_M 2074..2176 CDD:278785 59/102 (58%)
FERM_C2_MyoVII 2172..2267 CDD:270020 84/95 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369661230
eggNOG 1 0.900 E2759_KOG4229
Hieranoid 1 1.000
Homologene 1 1.000 H219
Inparanoid 1 1.050 2588 1.000 Inparanoid score I25
OMA 1 1.010
OrthoDB 1 1.010 D21221at33208
OrthoFinder 1 1.000 FOG0001665
OrthoInspector 1 1.000 T1087233
orthoMCL 1 0.900 OOG5_127340
Panther 1 1.100 LDO PTHR13140
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.