DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ck and Myo81F

Sequence 1:NP_001285949.1 Gene:ck FlyBaseID:FBgn0000317 Length:2167 Species:Drosophila melanogaster
Sequence 2:NP_001303492.1 Gene:Myo81F FlyBaseID:FBgn0267431 Length:2082 Species:Drosophila melanogaster

Alignment Length:2308 Identity:602/2309 (26%)
Similarity:981/2309 (42%) Gaps:463/2309 (20%)


  Fly    64 GVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGEL 128
            |..||..:.::.|.||.:||.:||..::|||||||||:|||||:.:.|:....|..|...|:|:|
  Fly     9 GFADMTEMSEIDEIGINQNLNVRYNSDIIYTYTGSILLAVNPYKTINIFNKQTISEYHTCKLGDL 73

  Fly   129 PPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAI-SGKHSWIEQQILEANP 192
            .||:||:.:.||..:.....:|..|||||||||||||||.|||||..| |...||::|||||||.
  Fly    74 SPHVFAVAEAAYTSIVDDNINQACVISGESGAGKTESTKFILQYLCTITSNVSSWVQQQILEANT 138

  Fly   193 ILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCIL 257
            ||||||||||.||||||||||::.:.|..|..|:|..|..||||:|||..|:..|||||:.|.::
  Fly   139 ILEAFGNAKTTRNDNSSRFGKFMQVCFDDNNCIKGCVILDYLLEQSRITFQSEGERNYHIMYQLV 203

  Fly   258 AGLSADEKSRLDLGMAAD--------YKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIW 314
            |      :.:.::|:|..        ||||...||.......::.:|..:..|..||......|.
  Fly   204 A------QGQKNIGIANTFHLRPAEFYKYLNTSNSEKINMNLESKKFDAVTMAFTVLQIPQFVID 262

  Fly   315 EIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGET 379
            .:.|:::::|..|||::.....:..|.|...:.. :..::.||||........|..|.:...|..
  Fly   263 GVFKVISSILWLGNIEFIDVDGEVTDLTRSDQEA-ISIISMLLGLSRCDFKKVLLIRQINVRGNI 326

  Fly   380 VVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAIFKPRGTSRNAIGVLDIFGFENFDQNSFE 444
            ....|...::::.|.|..|.:|.:||..:|.|||... .|.......:|||||||||||..||||
  Fly   327 TEIPLKIKEALENRHALAKALYSKMFTWLVSKINNCT-NPGQDDAKFLGVLDIFGFENFSHNSFE 390

  Fly   445 QFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEAR 509
            |.||||.||.|.:||..::|.|||..|.||.|.:.|:||.||...|:::......:..|:.|:..
  Fly   391 QLCINYTNEKLHKFFNHYVFALEQSIYEHEGIYFNHVEFTDNTPCLEILEKPPRCVFKLLTEQCH 455

  Fly   510 FPKGTDQTMLAKLHKTHGSHKNYLK--PKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLL 572
            .|:|:|...|:.:|....||.||:|  .:....|.||:.|:||:|.|...||::||||.....:.
  Fly   456 MPQGSDLAFLSNMHTEFESHPNYIKGSDRRHWETEFGIKHYAGLVIYAVGGFVEKNRDVQQDVMF 520

  Fly   573 HLVSQSTNKFLRQIFA-QDIEM-------GAETRKRTPTLSTQFRKSLDALMKTLSSCQPFFIRC 629
            ..:|.|.:.|::.:.. |||:.       |:.  |...|:|..||..|.:|:..|.:.:|:::||
  Fly   521 EYMSYSKDVFIKDLSTYQDIQFINSSYPRGSS--KSKCTVSDNFRNQLQSLIDVLQNTKPWYVRC 583

  Fly   630 IKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPG----VPPAH 690
            ||||..|:|..::..|...||:|.|:::.|||||.|:||....::|:.||:.||..    .|..:
  Fly   584 IKPNLQKRPNNYNSSLVLDQLKYLGVVDIIRIRREGFPIHLSHKDFIVRYKCLIKNKSFEYPQKY 648

  Fly   691 RTDCQAATSRICAVVLGK-----SDYQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGW 750
            .|:           :|.|     :::|:|.:|:||::|....||..|...|.:..:|:|::.:.:
  Fly   649 LTN-----------ILEKNGMPTTEWQIGKSKIFLRNAAYELLETNRKDTLYKNAVIIQKNWKKY 702

  Fly   751 VYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAH 815
            ..::.|||.:.|.:.:|..::|:..|.|:..||          ||.::                 
  Fly   703 YIQKSFLRNKQAVLRIQHAYRGWRLRIRFMRMR----------RSAIV----------------- 740

  Fly   816 ARGYLVRREYGHKMWAVIKIQSHVRRMIAMRRYRKLRLEHKQFAEVLQLRKLEEQELLHRGNKHA 880
                               |||.:|.:.|......||          ::::::|           
  Fly   741 -------------------IQSRLRGVFAREVAAALR----------EMKRVDE----------- 765

  Fly   881 REIAEQHYRDRLHELERRE-IQEQLEN---------RRRVEVNMNI---INDAARKQEEPVDDGK 932
                         ||::|: |.|||.:         .|.::..:::   |:|..|...:|:.|..
  Fly   766 -------------ELKKRDGIYEQLTSITTKTLADCERSIQEELSVLAHISDNIRASAKPLSDKN 817

  Fly   933 ----------------LVEAMFDFLPDSSSDAPTPHGGRETSVFNDLPHAQNVNQDDIIAPIHIS 981
                            .::.|||||.:|.       |..|.::..::    |.|.::::..:   
  Fly   818 DSDSNTARSSIKQNTVNLDNMFDFLCESK-------GAFENALIKEI----NDNWNNLVKNL--- 868

  Fly   982 EDEE------DLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPLHTQGDQLAA--------QAL 1032
             |||      ....|..||....:....|      :.|..|.:|.......::|        :|:
  Fly   869 -DEEIGLCIHTEDSFDSQKTGKLFTTKTV------RTLPEPTVPPPPPPVSISANLNSEPIYEAI 926

  Fly  1033 WITILRFTGDMPEPKYHTMD---------RMDTTSVMSKVTATLGRNFIR---SKEFQEAQLMGL 1085
            .:..|..|.::.:.||..:|         :..|:||..|.......|..:   .|:..|..|:.:
  Fly   927 NLYKLTTTKEIKKEKYMLLDYKSIKDNSKKPSTSSVFVKYQIDERENRRKQRVEKKIHELTLIDI 991

  Fly  1086 DPDAFLKQKPRSI---------RHKLVS-----LTLKRKNKLGEDVRRRLQDDEYTADSYQSWLQ 1136
            ..|..:.....:|         .|.|.|     .|..:|.|..:...:.    |.|..|....: 
  Fly   992 HKDIHIDNSFYNILEFAENYFNTHDLSSDCNFISTPTQKGKSSDKTAKH----EMTMFSKSDKI- 1051

  Fly  1137 SRPTSN--------------------------------LEKLHFIIGHGILRAELRDEIYCQICK 1169
              |||:                                |:.:.:|:|.||.|.||||||:.|..:
  Fly  1052 --PTSHIHMYDPENVVLSCSMFRELCKYMRGELNAERELQIIQYIVGLGIEREELRDEIFIQCIR 1114

  Fly  1170 QLTNNPLKSSHARGWILLSLCVGCFAPSEKFVNYLRAFIREGP-------PGYAPYCEERLKRTF 1227
            |..|||......|.||:|.|.:..|.||:....|..:||::..       ..|:.:|.:..|.| 
  Fly  1115 QSRNNPNIDWTDRIWIILCLSIVAFQPSKLLFRYFVSFIKKSMIELDGKLRQYSQWCFDNCKST- 1178

  Fly  1228 NNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLKDQFGFS 1292
            ...||..|||.:|:.|.:....|:....|:|..||.:......||.:...:|::|::|....|::
  Fly  1179 KVSTRMYPPSSVEVAAMRRLGTIVCRFFFLDARTKAIDVHPTDTAGDAVQKLAEKLNLTTTDGWA 1243

  Fly  1293 LYIALFDKVSSLGSGGDHVMDAISQCEQ----YA--KEQGAQERNAPWRLFFRKEIFAPWHEPTH 1351
            :|....|....:.| .|::.|.||..|.    ||  |:......:...:..|:|.:|...||.:.
  Fly  1244 IYQNRPDGEEHIKS-YDYLYDVISSWEMKQATYAGTKKTTNGSSSGENQFVFKKRLFKSTHELSQ 1307

  Fly  1352 DQVATNLIYQQVVRG-VKFGEYRCDKEEDLAMIAAQ----------QYFIEYSTDMSMERLFTLL 1405
            |.|..:::|.|.|.. ||..|:...::..|.:...|          |...||.:|::        
  Fly  1308 DPVEVSMLYSQAVHSVVKKDEFPVSEKVALQLAGLQAQVALGDPSNQPKPEYYSDIN-------- 1364

  Fly  1406 PNFIPDFCLSGVDKAIER--WAALVLQAYKKSYYVKDKI-APLKIKEDIVSYAKYKWPLLFSRFY 1467
             :|:|    ..:.|..|:  |..::.||:::....::.: |.:.....::.|..| ...:|...|
  Fly  1365 -SFLP----IRISKTREQQFWIPILAQAHRQYGSSRNALTAKVLYLSCVMQYPLY-GTTMFKVNY 1423

  Fly  1468 EAYRNSGPNLPKNDVIIAVNWTGVYVVD-------------DQEQVLLELSFPEITAVSSQKTNK 1519
            :.|.|...|     :|:.:::.|:..::             |.|.:||:.|...||...::....
  Fly  1424 KGYWNLASN-----IILGIHYDGIMFINPEDKSVVFQFKYVDIESILLDPSDSFITISLNRSAQL 1483

  Fly  1520 VFTQTFSLSTVRGEE-FTFQSPNAEDIRDLVV--------YFLDGLKKRSKYVIALQDYRAPSDG 1575
            :.|..:..|.:..:: |.|::|...||..|::        :.|:.|:...||           .|
  Fly  1484 LKTSLYGSSLIESQKCFVFETPQKNDIGSLIISYYPALSNWILNNLECSKKY-----------KG 1537

  Fly  1576 TSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAETVYVLPTLSKPPQDILALFN 1640
            |:     |.|.:.|...            :..|.|.           .|...:.|.|.|.     
  Fly  1538 TT-----KEDRLRLYQN------------VVLCRRH-----------LVDMNIVKKPHDF----- 1569

  Fly  1641 IEEAHHGRRLSMASNGGAVEPRDRPHTLMEYALDHFRLPPKRTMSKTLTLSSKRSEELWRYSRDP 1705
                           ||.:  |:....|.::.|:..|........:........|...|.:|:..
  Fly  1570 ---------------GGFL--RNTLRRLSKHRLEKLRSEVGSNTQEHGETYKGFSHTFWAFSKQQ 1617

  Fly  1706 IKAPLLRKLQSKEEFAEEACF--AFAAILKYMGDLPSKRPRMGNEITDH------IFDGPLKHEI 1762
            |  |......|.:   |||..  .|.:||.|.| |.|....:.....:|      |.|..:|.|.
  Fly  1618 I--PFCISTISDQ---EEALMIQVFDSILTYSG-LGSSGESISRAEDEHIRIIQSIMDKCMKKES 1676

  Fly  1763 LRDEIYCQLMKQLTD--NRNRMSEERGWELM----------------WLATGLFACSQGLLKELL 1809
            |.:|:|.||:||.||  :.|.....:.|.|:                :|...|..||...|.|..
  Fly  1677 LLNELYLQLIKQTTDHPDANSRVNLKNWALLSVLCSVILPSMKAVRKYLIAHLKRCSSDFLSEEG 1741

  Fly  1810 LFLRTRRHPISQDSMHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSS 1874
            .:.|     .:::...|.|.|.|   |::.|.:.|:....:: ...:.|.||.|....:.|...|
  Fly  1742 KYAR-----YAENCFFRTQGTRR---RQWTPSREEILCTTNR-RPCYSKFYFMDGQYYSIEFQPS 1797

  Fly  1875 TRAKDFCNNISQRLS-LRTSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPIRDG--- 1935
            :.|.|....|.:::. |..::|:|::..|.:...|:...:...|.   :..|.|.....:.|   
  Fly  1798 STANDVLEIIKKKIGLLDNAKGYSIYEVIGNSERSLSSEEKVCDV---MAKWEKYQITSQQGFQK 1859

  Fly  1936 ----ANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFR 1996
                .:.|..|...|.|.|:.:.....:...:....|||.|..|....:..:..||..|.||..:
  Fly  1860 NTTLISQQNQYMFLFKKHLFFDNYINLEDIVEKELLYHQILHNLRSERYPITEMEAIMLTALQSQ 1924

  Fly  1997 VRFGENKQEL--------QAIPQMLRELIPSDIMKIQSTSEWKRSIVASYNQD-GGMTSEDAKVA 2052
            :..|:..:.:        ..:|......||.:             .||.::|. .||...:||.|
  Fly  1925 LERGDCCESITDYRAVASHCLPPRFVPNIPHE-------------AVAMHHQSLRGMLPIEAKKA 1976

  Fly  2053 FLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRISNWSSGN 2117
            ||.::..||...:..|:|.|:...|:|..|.:||::.|:.|:...::::|.|:.:..|.::|...
  Fly  1977 FLNLIKSWPLHRATIFDVMQSFTTNWPRTLWLAIDQKGIHLLEHRSRNVLCTYGYDSIISFSPNL 2041

  Fly  2118 TYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSY 2150
            ....:..|...:.||::..|...|::..|:..|
  Fly  2042 NSLMIFTGTEKKQSKVILTTPQAYQITTLIREY 2074

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ckNP_001285949.1 MYSc 64..733 CDD:214580 267/697 (38%)
MYSc_Myo7 77..721 CDD:276832 259/672 (39%)
MyTH4 <1138..1245 CDD:214535 42/146 (29%)
B41 1251..1467 CDD:214604 51/236 (22%)
FERM_B-lobe 1355..1439 CDD:271216 19/97 (20%)
FERM_C1_MyoVII 1461..1559 CDD:270019 24/120 (20%)
SH3 1560..1624 CDD:302595 9/64 (14%)
MyTH4 1701..1849 CDD:214535 45/174 (26%)
B41 1856..2068 CDD:214604 49/229 (21%)
FERM_M 1966..2068 CDD:278785 26/111 (23%)
FERM_C2_MyoVII 2064..2159 CDD:270020 21/88 (24%)
Myo81FNP_001303492.1 MYSc 8..685 CDD:214580 267/697 (38%)
Motor_domain 23..673 CDD:277568 259/671 (39%)
MyTH4 1091..1194 CDD:279165 37/104 (36%)
B41 1202..1419 CDD:214604 50/232 (22%)
UBQ 1202..1297 CDD:294102 23/96 (24%)
FERM_M 1307..1419 CDD:278785 24/126 (19%)
PH-like 1415..1523 CDD:302622 22/113 (19%)
MyTH4 1664..1771 CDD:279165 30/115 (26%)
UBQ 1780..1860 CDD:294102 18/83 (22%)
B41 1781..1992 CDD:214604 49/227 (22%)
FERM_B-lobe 1893..1984 CDD:271216 24/104 (23%)
PH-like 1988..2076 CDD:302622 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D21221at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13140
RoundUp 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.