DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-c and rgn

DIOPT Version :8

Sequence 1:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001006822.1 Gene:rgn / 448549 XenbaseID:XB-GENE-483637 Length:299 Species:Xenopus tropicalis

Alignment Length:167 Identity:38/168 (23%)
Similarity:50/168 (30%) Gaps:59/168 (35%)


  Fly    62 PLGVERWQNRIFVTVP-----------------RWKAGVAATLNYIDINSTEKSPKLHPYPSWEA 109
            |..|||.|..:|...|                 .|... ..||.|||..|               
 Frog   124 PAVVERNQGSLFTLYPDHSVVKHFDMVDISNGLDWSLD-HKTLYYIDSLS--------------- 172

  Fly   110 NKLPIDVQPQDQKT-PSGGRLDADK-AQDAGIQLKDNSTVISTFRIQVDVCDRLWVLDTGLADIL 172
              ..:|....|.|| .|..|....| .||.||  .|.        :.:|...:|||     |...
 Frog   173 --FKVDALDYDMKTGKSSNRRTLYKLQQDEGI--PDG--------MCIDAEGKLWV-----ACYN 220

  Fly   173 GSPKQITPNSILVFDLKTDTLLRRFTIPADQTKEDSF 209
            |       ..::..|.:|...::...:|.|:|....|
 Frog   221 G-------GRVIRIDPETGKQIQTVKLPVDKTTSCCF 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 12/63 (19%)
rgnNP_001006822.1 SGL 17..263 CDD:312077 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.