DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rnmt and RNMT

Sequence 1:NP_523568.2 Gene:Rnmt FlyBaseID:FBgn0286027 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_011524051.1 Gene:RNMT HGNCID:10075 Length:512 Species:Homo sapiens

Alignment Length:432 Identity:171/433 (39%)
Similarity:256/433 (59%) Gaps:41/433 (9%)


  Fly     6 EQNAADEQFARAHKAVSLSDDEESEGQAETTSAPNQ----EPHV--------------SKSPREY 52
            |:.:...|...|.|.....||...|..:.....|::    :|.:              .|..||.
Human    45 EKTSVCRQVDIARKRKEFEDDLVKESSSCGKDTPSKKRKLDPEIVPEEKDCGDAEGNSKKRKRET 109

  Fly    53 YDEPGGKGN-GSGADD------QDEPETEAASGAANTHVVAHHYNELKEAGRKDRQKSKIFFMRN 110
            .|.|..|.: |.|..:      :|.||.:......::..||.|||||:|.|.:.|.:|:||::||
Human   110 EDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRN 174

  Fly   111 FNNWIKSQLINEYMSQIKQNKRMGDALRVLDMCCGKGGDLLKWEKAAISHLICTDIAEVSVEQCQ 175
            ||||:||.||.|::.:::|.|:..  :.|||:.||||||||||:|..|:.|:|||||:|||:|||
Human   175 FNNWMKSVLIGEFLEKVRQKKKRD--ITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQ 237

  Fly   176 RRYQDILQRSEKSKFANKFTAEFFACDSTLVRLRERYKDPSLQLNLVSCQFAFHYCFESMAQADC 240
            :||:|:..|.:....   |:|||...||:...|.::::||.:..::.||||..||.|||..|||.
Human   238 QRYEDMKNRRDSEYI---FSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADM 299

  Fly   241 MMRNAAECLKPGGFFIATMPDAYEIIRRLRAAGPDARRFGNDVYSIEFDCETDPLPLFGAKYQFH 305
            |:|||.|.|.|||:||.|.|:::|:||||.|:  :...|||::|:::|..:.| .||||.||.|:
Human   300 MLRNACERLSPGGYFIGTTPNSFELIRRLEAS--ETESFGNEIYTVKFQKKGD-YPLFGCKYDFN 361

  Fly   306 LEGVVDCPEFLVHFPTLVKLGRKYGLQLLKRSTFADYYKENL--HHGRHLLQRMSGLESVQPQR- 367
            ||||||.|||||:||.|.::.:||.::|:.:.||.::|:|.:  :..:.||:||..||...... 
Human   362 LEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANES 426

  Fly   368 ----CENDEEFAHVSNF-QGAQRSRSVGTLSKSEWEAATLYL 404
                .|..:::.|.:.: :.:|....:||||||||||...:|
Human   427 SKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATRSFL 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RnmtNP_523568.2 Pox_MCEL 72..411 CDD:281307 152/342 (44%)
RNMTXP_011524051.1 Pox_MCEL 136..468 CDD:281307 151/340 (44%)
SmtA 196..414 CDD:223574 107/226 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296367988
eggNOG 1 0.900 E1_KOG1975
Hieranoid 1 1.000
Homologene 1 1.000 H2816
Inparanoid 1 1.050 321 1.000 Inparanoid score I2488
Isobase 1 0.950 0 Normalized mean entropy S2396
OMA 1 1.010
OrthoDB 1 1.010 D1390749at2759
OrthoFinder 1 1.000 FOG0003991
OrthoInspector 1 1.000 T1074276
orthoMCL 1 0.900 OOG5_127958
Panther 1 1.100 LDO PTHR12189
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R689
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.