DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: THG and THG1

Sequence 1:NP_001188815.1 Gene:THG FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_011538.3 Gene:THG1 SGDID:S000003256 Length:237 Species:Saccharomyces cerevisiae

Alignment Length:222 Identity:120/223 (54%)
Similarity:160/223 (72%) Gaps:4/223 (2%)


  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65
            ||.|:|.||:.||..|.|||..:||:||||||||:|||.::|.||||||||.:|||.|..::.::
Yeast     1 MANSKFGYVRQFETHDVILPQCYIVVRIDGKKFHEFSKFYEFAKPNDENALKLMNACAKNLVLKY 65

  Fly    66 R-DIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM---NLPLAYAPCF 126
            : ||:||:|:||||||:.:..|..|.||..||.|...|.|:|:||..|:|:.   .|.:.:.|.|
Yeast    66 KNDIILAFGESDEYSFILKSSTTLFNRRKDKLATLFGSFFTSNYVALWAKFFPEKPLNIKHLPYF 130

  Fly   127 DGRVVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLF 191
            |.|.|.||:.|.:|||||||..|.|:||||||.||:|:::.|||.|::|.||.||||.:|.|:||
Yeast   131 DSRCVAYPNLQTIKDYLSWRYVDTHINNLYNTTFWQLIIKCGLTPQESEKKLCGTFSNEKQEILF 195

  Fly   192 QEFGINYNNLPAMYRKGTILLRKRVIL 218
            .|.||||||.|.|::||:::.||..||
Yeast   196 SECGINYNNEPEMFKKGSLVTRKGEIL 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
THGNP_001188815.1 Thg1 2..239 CDD:226508 119/222 (54%)
Thg1 9..134 CDD:282322 65/129 (50%)
Thg1C 137..234 CDD:291110 49/83 (59%)
THG1NP_011538.3 Thg1 2..237 CDD:226508 119/222 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166006849
eggNOG 1 0.900 E1_COG4021
Hieranoid 1 1.000
Homologene 1 1.000 H5959
Inparanoid 1 1.050 247 1.000 Inparanoid score I664
Isobase 1 0.950 0 Normalized mean entropy S995
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004530
OrthoInspector 1 1.000 T1136146
orthoMCL 1 0.900 OOG5_129044
Panther 1 1.100 LDO PTHR12729
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1510
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.