DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: THG and AT2G32320

Sequence 1:NP_001188815.1 Gene:THG FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001154544.1 Gene:AT2G32320 AraportID:AT2G32320 Length:537 Species:Arabidopsis thaliana

Alignment Length:251 Identity:114/252 (45%)
Similarity:168/252 (67%) Gaps:12/252 (5%)


  Fly     7 EYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEFRDIVLA 71
            :|||||:.:..:||..|:|:||||..||:||:.|:|||||||.||.:||:.|.||::||:||..|
plant   285 DYVKSFQFESRLLPLTWVVVRIDGCHFHRFSEVHEFEKPNDEQALKLMNSCAVAVLEEFQDIAFA 349

  Fly    72 YGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGRVVLYPS 135
            ||.|||:|||.:.::..:||:|:|:::.|.|.|:|:|:|:|..:. :..|.|.|.||||.|.||:
plant   350 YGVSDEFSFVLKNKSELYKRQSSKIISAVVSFFTSTYMMRWGDFFPHKKLKYPPSFDGRAVCYPT 414

  Fly   136 EQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEFGINYNN 200
            ...|.|||:|||.|.|:||.|||.||.|| :.|.:..||:..|:||.:.:|||||.|:|||.||:
plant   415 SDILLDYLAWRQVDCHINNQYNTCFWMLV-KSGKSKIQAQDYLKGTQTREKNELLSQQFGIEYNS 478

  Fly   201 LPAMYRKGTILLRKRV----------ILGEKSRQAVVPLHEDLISSQFWKEHTEIL 246
            ||.::|.|:.:.|.:.          :.|::....|...:.::|...||::|..||
plant   479 LPVIFRMGSSVFRLKTQEGVTEENGEVSGKQVEAEVGVDYSNIIDQCFWQQHPHIL 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
THGNP_001188815.1 Thg1 2..239 CDD:226508 110/243 (45%)
Thg1 9..134 CDD:282322 64/126 (51%)
Thg1C 137..234 CDD:291110 42/107 (39%)
AT2G32320NP_001154544.1 Thg1 9..132 CDD:282322
Thg1C 138..252 CDD:291110
Thg1 286..531 CDD:226508 112/246 (46%)
Thg1 287..413 CDD:282322 64/126 (51%)
Thg1C 417..522 CDD:291110 42/106 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5959
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125102
orthoMCL 1 0.900 OOG5_129044
Panther 1 1.100 O PTHR12729
Phylome 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.