DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: THG and SPCC63.07

Sequence 1:NP_001188815.1 Gene:THG FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_587981.1 Gene:SPCC63.07 PomBaseID:SPCC63.07 Length:261 Species:Schizosaccharomyces pombe

Alignment Length:259 Identity:140/260 (54%)
Similarity:180/260 (69%) Gaps:13/260 (5%)


  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65
            ||.|||||||.:|:.|.:||..:||||||||.||||:|.||||||||...||:|||||..||.||
pombe     1 MAKSRFEYVKQYERLDRLLPETYIVIRIDGKGFHKFTKKHDFEKPNDLRCLNLMNAAARVVMSEF 65

  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWMNLPLAYAPCFDGRV 130
            .|||||||.|||||||:.|.|..::||.:||:::|.|||:|::|..|.|..::||...|.||||.
pombe    66 TDIVLAYGDSDEYSFVWSKSTELYERRESKLVSHVCSLFTSAFVFNWPKHFDIPLLSLPSFDGRA 130

  Fly   131 VLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEFG 195
            ||||:.:.|:|||.|||.|.|:||||||.||.|:|:.|.||.|||..|:||.||:|:|:||.:||
pombe   131 VLYPNMKVLRDYLHWRQVDCHINNLYNTTFWMLILKGGFTNTQAEEYLKGTVSAEKHEILFSKFG 195

  Fly   196 INYNNLPAMYRKGTILLR-----------KRVILGEKSRQAVVPLHEDLISSQFW--KEHTEIL 246
            ||||..|.:|:||:|.:|           |:..:.:|.:..:..||..||...||  :...|:|
pombe   196 INYNFEPEIYKKGSIWIREPIDQEWHQQDKKFSVKQKKKMVLSILHVSLIDDDFWTSRPFLEVL 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
THGNP_001188815.1 Thg1 2..239 CDD:226508 136/248 (55%)
Thg1 9..134 CDD:282322 76/125 (61%)
Thg1C 137..234 CDD:291110 51/108 (47%)
SPCC63.07NP_587981.1 Thg1 2..254 CDD:226508 137/252 (54%)
Thg1 9..134 CDD:282322 76/125 (61%)
Thg1C 137..245 CDD:291110 51/108 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5959
Inparanoid 1 1.050 283 1.000 Inparanoid score I647
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004530
OrthoInspector 1 1.000 T1124996
orthoMCL 1 0.900 OOG5_129044
Panther 1 1.100 LDO PTHR12729
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1510
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.