DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: THG and LOC101733043

Sequence 1:NP_001188815.1 Gene:THG FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_004920397.2 Gene:LOC101733043 ID: Length:240 Species:Xenopus tropicalis

Alignment Length:213 Identity:125/214 (58%)
Similarity:163/214 (76%) Gaps:1/214 (0%)


  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65
            ||.|:||||:.||..|:.|.|.|:::|:||:.||:|::.|.|.||||..:|.:||..|..||.|.
 Frog    26 MAKSKFEYVRDFEVQDTCLRNCWVLVRVDGRNFHRFAEQHHFTKPNDVRSLQLMNRCAQNVMDEL 90

  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129
            .||.|||||||||||||.|::..:|||::|.:|:|.|.|:||||..|.::. ::|:...|.||||
 Frog    91 DDICLAYGQSDEYSFVFHKKSNWYKRRASKFMTHVVSQFASSYVFYWKEYFPDVPILCPPGFDGR 155

  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194
            ||||||||||||||||||||.|:||||||.||.||.:.|||..||:.:|:||.:|:|||:||.||
 Frog   156 VVLYPSEQNLKDYLSWRQADCHINNLYNTVFWSLVQKGGLTPAQAQDRLKGTLAAEKNEILFSEF 220

  Fly   195 GINYNNLPAMYRKGTILL 212
            .|||||.|.:||||::|:
 Frog   221 NINYNNEPLLYRKGSVLI 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
THGNP_001188815.1 Thg1 2..239 CDD:226508 124/213 (58%)
Thg1 9..134 CDD:282322 65/126 (52%)
Thg1C 137..234 CDD:291110 51/77 (66%)
LOC101733043XP_004920397.2 Thg1 27..238 CDD:226508 124/211 (59%)
Thg1 34..160 CDD:282322 65/126 (52%)
Thg1C 163..>240 CDD:291110 51/77 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5959
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1152974at2759
OrthoFinder 1 1.000 FOG0004530
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.