DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)35Be and Ankrd49

Sequence 1:NP_609735.1 Gene:l(2)35Be FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001335189.1 Gene:Ankrd49 MGIID:1930842 Length:238 Species:Mus musculus

Alignment Length:226 Identity:91/227 (40%)
Similarity:132/227 (58%) Gaps:31/227 (14%)


  Fly     7 DDEK-------------SQVEKLR-HAK-VPRG---MFVSGWDDDADELIEEDKNP--------- 44
            ||||             :|:|.|: |.. :|.|   ::|...|:|.:   :|:||.         
Mouse     7 DDEKPDLENSVDFSEQFNQLELLKTHGHLIPTGTQSLWVGNSDEDEE---QEEKNEEWYQLQEKK 68

  Fly    45 -QSSIERMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANP 108
             :....:::|||..:||::.|:.:|...|..||.:|.|.|||||||||:..:|:.:.|:...|:.
Mouse    69 MEKDPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHIDVVRELVAKGADV 133

  Fly   109 NARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRY 173
            :|.|..|||||||||||||...|..|||..||:||::.|..||||:.|...:.|:|..:||::||
Mouse   134 HAVTVDGWTPLHSACKWNNTKVASFLLQHDADINAQTKGLLTPLHLAAGNRDSRDTLELLLMNRY 198

  Fly   174 IQPRKENNSEELASVIARRTGMSFPIFESGE 204
            |:|..:|||:|.||.|||||.:...:||..|
Mouse   199 IKPELKNNSQETASDIARRTSIYHYLFEIAE 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 10/27 (37%)
ANK 54..169 CDD:238125 55/115 (48%)
Ank_5 67..120 CDD:290568 25/53 (47%)
ANK repeat 81..112 CDD:293786 14/31 (45%)
Ank_5 100..154 CDD:290568 30/54 (56%)
ANK repeat 114..144 CDD:293786 21/30 (70%)
ANK repeat 147..180 CDD:293786 14/33 (42%)
Ankrd49NP_001335189.1 ANK 1 72..105 11/33 (33%)
ANK 77..194 CDD:238125 56/117 (48%)
ANK repeat 77..104 CDD:293786 10/27 (37%)
ANK repeat 106..137 CDD:293786 14/31 (45%)
ANK 2 106..135 13/29 (45%)
ANK repeat 139..169 CDD:293786 21/30 (70%)
ANK 3 139..168 20/29 (69%)
ANK 4 172..205 14/33 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243752731
eggNOG 1 0.900 E2759_KOG0512
Hieranoid 1 1.000
Homologene 1 1.000 H9787
Inparanoid 1 1.050 157 1.000 Inparanoid score I4239
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1546307at2759
OrthoFinder 1 1.000 FOG0007676
OrthoInspector 1 1.000 T1083671
orthoMCL 1 0.900 OOG5_133195
Panther 1 1.100 LDO PTHR24144
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4168
TreeFam 1 0.960
1312.890

Return to query results.
Submit another query.