DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)35Be and ankrd49

Sequence 1:NP_609735.1 Gene:l(2)35Be FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001017584.2 Gene:ankrd49 ZFINID:ZDB-GENE-050417-46 Length:218 Species:Danio rerio

Alignment Length:210 Identity:80/211 (38%)
Similarity:118/211 (56%) Gaps:15/211 (7%)


  Fly     5 DSDDEKSQVEKLRHAKVPRGMFVSGWDDDADELIEEDK-------------NPQSSIERMILWAV 56
            |..::.:|:|.|....:|.|. .|.|.:: :|..|||:             :.|.:...::|||.
Zfish     2 DFPEDFNQLELLDPHVIPMGT-RSNWAEE-EEGEEEDEAMHTEEWHQQQELHLQDTPSELMLWAA 64

  Fly    57 NENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHS 121
            ..||.:.|..::.||...||..|:|||||||||||:...|:|..||:..||.:|||...|.||||
Zfish    65 ERNRCATVERLIALDPTLVNCHDSDGYTPLHRAAYSGHHDVASALLKAGANLHARTADDWMPLHS 129

  Fly   122 ACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEELA 186
            ||:|.:|:.|.||||:|::|||.:.|:.|||.:.|..:....|..:||..|.::...:|::.|.|
Zfish   130 ACRWGHANVASLLLQWGSEVNAMTAGRLTPLQLAAGNAAAGKTIELLLSQRTLEAGLKNSAGETA 194

  Fly   187 SVIARRTGMSFPIFE 201
            ..||.||.....:||
Zfish   195 YDIAHRTSELHRLFE 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 10/27 (37%)
ANK 54..169 CDD:238125 55/115 (48%)
Ank_5 67..120 CDD:290568 28/53 (53%)
ANK repeat 81..112 CDD:293786 19/31 (61%)
Ank_5 100..154 CDD:290568 29/54 (54%)
ANK repeat 114..144 CDD:293786 18/30 (60%)
ANK repeat 147..180 CDD:293786 9/33 (27%)
ankrd49NP_001017584.2 ANK 62..166 CDD:238125 53/104 (51%)
Ank_2 62..151 CDD:289560 47/89 (53%)
ANK repeat 89..120 CDD:293786 19/31 (61%)
ANK repeat 122..151 CDD:293786 17/29 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243749793
eggNOG 1 0.900 E2759_KOG0512
Hieranoid 1 1.000
Homologene 1 1.000 H9787
Inparanoid 1 1.050 133 1.000 Inparanoid score I4509
OMA 1 1.010
OrthoDB 1 1.010 D1546307at2759
OrthoFinder 1 1.000 FOG0007676
OrthoInspector 1 1.000 T1052900
orthoMCL 1 0.900 OOG5_133195
Panther 1 1.100 LDO PTHR24144
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4168
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.