DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)35Be and ANKRD49

Sequence 1:NP_609735.1 Gene:l(2)35Be FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_060174.2 Gene:ANKRD49 HGNCID:25970 Length:239 Species:Homo sapiens

Alignment Length:212 Identity:86/213 (40%)
Similarity:126/213 (59%) Gaps:18/213 (8%)


  Fly     5 DSDDEKSQVEKLR-HAK-VPRG---MFVSGWDDDADELIEEDKNP----------QSSIERMILW 54
            |..:..:|:|.|. |.. :|.|   ::|...|:|.:   ::|||.          :....|::||
Human    19 DFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEE---QDDKNEEWYRLQEKKMEKDPSRLLLW 80

  Fly    55 AVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPL 119
            |..:||::.||.:|...|..||.:|.|.|||||||||:..:|:.:.|:...|:.:|.|..|||||
Human    81 AAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPL 145

  Fly   120 HSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEE 184
            ||||||||...|..|||..||:||::.|..||||:.|...:.::|..:||::||::|..:||.||
Human   146 HSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEE 210

  Fly   185 LASVIARRTGMSFPIFE 201
            .|..|||||.:...:||
Human   211 TAFDIARRTSIYHYLFE 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 11/27 (41%)
ANK 54..169 CDD:238125 55/115 (48%)
Ank_5 67..120 CDD:290568 25/53 (47%)
ANK repeat 81..112 CDD:293786 14/31 (45%)
Ank_5 100..154 CDD:290568 30/54 (56%)
ANK repeat 114..144 CDD:293786 21/30 (70%)
ANK repeat 147..180 CDD:293786 12/33 (36%)
ANKRD49NP_060174.2 ANK 1 73..103 12/30 (40%)
ANK 78..195 CDD:238125 56/117 (48%)
ANK repeat 78..105 CDD:293786 11/27 (41%)
ANK repeat 107..138 CDD:293786 14/31 (45%)
ANK 2 107..136 13/29 (45%)
ANK repeat 140..170 CDD:293786 21/30 (70%)
ANK 3 140..169 20/29 (69%)
ANK 4 173..206 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243749196
eggNOG 1 0.900 E2759_KOG0512
Hieranoid 1 1.000
Homologene 1 1.000 H9787
Inparanoid 1 1.050 153 1.000 Inparanoid score I4281
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1546307at2759
OrthoFinder 1 1.000 FOG0007676
OrthoInspector 1 1.000 T1073588
orthoMCL 1 0.900 OOG5_133195
Panther 1 1.100 LDO PTHR24144
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4168
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.