DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)35Be and Ankrd49

Sequence 1:NP_609735.1 Gene:l(2)35Be FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001119755.1 Gene:Ankrd49 RGDID:1311759 Length:239 Species:Rattus norvegicus

Alignment Length:214 Identity:91/215 (42%)
Similarity:130/215 (60%) Gaps:16/215 (7%)


  Fly     5 DSDDEKSQVEKLR-HAK-VPRG--MFVSGWDDDADELIEEDKN------PQSSIE----RMILWA 55
            |..::.:|:|.|. |.. :|.|  ...:|..||.||  :|:||      .:..:|    :::|||
  Rat    19 DFSEQFNQLELLETHGHLIPTGTQSLWAGNSDDDDE--QEEKNEEWYQLQEKKLEKEPSKLLLWA 81

  Fly    56 VNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLH 120
            ..:||::.|:.:|...|..||.:|.|.|||||||||:..:|:.:.|:...|:.:|.|..||||||
  Rat    82 AEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHLDVVRELVAQGADVHAVTIDGWTPLH 146

  Fly   121 SACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEEL 185
            |||||||...|..|||..||:||::.|..||||:.|...:.|:|..:||::|||:|..:|||.|.
  Rat   147 SACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSRDTLELLLMNRYIKPELKNNSRET 211

  Fly   186 ASVIARRTGMSFPIFESGE 204
            ||.|||||.:...:||..|
  Rat   212 ASDIARRTSIYHYLFEIAE 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 10/27 (37%)
ANK 54..169 CDD:238125 55/115 (48%)
Ank_5 67..120 CDD:290568 25/53 (47%)
ANK repeat 81..112 CDD:293786 14/31 (45%)
Ank_5 100..154 CDD:290568 30/54 (56%)
ANK repeat 114..144 CDD:293786 21/30 (70%)
ANK repeat 147..180 CDD:293786 14/33 (42%)
Ankrd49NP_001119755.1 ANK 78..195 CDD:238125 56/117 (48%)
Ank_2 78..170 CDD:289560 47/92 (51%)
ANK repeat 78..105 CDD:293786 10/27 (37%)
ANK repeat 107..138 CDD:293786 14/31 (45%)
ANK repeat 140..170 CDD:293786 21/30 (70%)
Ank_5 160..216 CDD:290568 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243752350
eggNOG 1 0.900 E2759_KOG0512
Hieranoid 1 1.000
Homologene 1 1.000 H9787
Inparanoid 1 1.050 156 1.000 Inparanoid score I4139
OMA 1 1.010
OrthoDB 1 1.010 D1546307at2759
OrthoFinder 1 1.000 FOG0007676
OrthoInspector 1 1.000 T1087230
orthoMCL 1 0.900 OOG5_133195
Panther 1 1.100 LDO PTHR24144
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.