DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)35Be and F26F4.12

Sequence 1:NP_609735.1 Gene:l(2)35Be FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_498030.1 Gene:F26F4.12 WormBaseID:WBGene00017831 Length:231 Species:Caenorhabditis elegans

Alignment Length:215 Identity:74/216 (34%)
Similarity:109/216 (50%) Gaps:26/216 (12%)


  Fly     1 MGDYDSDDEKSQ---------------VEKLRHAKVPR-GMFVSGWDDDADELIEEDKNPQSSIE 49
            |.|.|.:|.::|               ::::|..|... |||||.|.||.:.|  |:||.:..||
 Worm     6 MADQDINDFEAQANAEDGVNLGFTKELIDEIRDKKESNPGMFVSAWQDDTEGL--EEKNMEDPIE 68

  Fly    50 RMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTEL 114
            :. |.|..:..:..|:.:|:...:.:|::|.||||.||||:|||...:...||...||..::|..
 Worm    69 KW-LTAAEDGELELVKVLLEETPNLLNSRDADGYTALHRASYNNHSPIVDHLLLSGANKESKTNE 132

  Fly   115 GWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKE 179
            |||||.||..|.|.:....||..|:||||.|:|..|.||: |..|.......|.:..||:.....
 Worm   133 GWTPLLSASNWANFEVVGRLLSHGSDVNALSNGNLTALHL-AVNSRSEEPENVYMTVRYLLQAPG 196

  Fly   180 NNSEELAS------VIARRT 193
            .::..:|.      ::||||
 Worm   197 IDAGVIAGNGDTPLMMARRT 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 5/27 (19%)
ANK 54..169 CDD:238125 45/115 (39%)
Ank_5 67..120 CDD:290568 24/53 (45%)
ANK repeat 81..112 CDD:293786 15/31 (48%)
Ank_5 100..154 CDD:290568 26/54 (48%)
ANK repeat 114..144 CDD:293786 16/30 (53%)
ANK repeat 147..180 CDD:293786 9/33 (27%)
F26F4.12NP_498030.1 Ank_2 73..161 CDD:289560 36/88 (41%)
ANK 94..215 CDD:238125 47/122 (39%)
ANK repeat 99..130 CDD:293786 15/31 (48%)
ANK repeat 132..161 CDD:293786 15/29 (52%)
Ank_5 152..213 CDD:290568 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243738769
eggNOG 1 0.900 E2759_KOG0512
Hieranoid 1 1.000
Homologene 1 1.000 H9787
Inparanoid 1 1.050 108 1.000 Inparanoid score I3451
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1546307at2759
OrthoFinder 1 1.000 FOG0007676
OrthoInspector 1 1.000 T474000
orthoMCL 1 0.900 OOG5_133195
Panther 1 1.100 LDO PTHR24144
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4168
TreeFam 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.