DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and ASB11

DIOPT Version :8

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_543149.1 Gene:ASB11 / 140456 HGNCID:17186 Length:323 Species:Homo sapiens

Alignment Length:216 Identity:47/216 - (21%)
Similarity:79/216 - (36%) Gaps:66/216 - (30%)


  Fly    27 VSGWDDDADELIEE----------DKNPQS---------SIERMILWAVNENRISEVREILKLDA 72
            |.|...:|..:.||          |::|..         :::.:|...||.|.:           
Human    41 VKGNRKEAARIAEEIYGGISDCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLV----------- 94

  Fly    73 DTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQF 137
             |:|.     .:.||.|.....|..||.||:..|:.|..|..|.|||.:||...:|.|.::||:|
Human    95 -TINR-----VSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCSGSAACVNVLLEF 153

  Fly   138 GADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEELASVIARRTGMSFPIFES 202
            ||....|       :|:.:.:.               :..|..:.|.:..::|....:...:.:.
Human   154 GAKAQLE-------VHLASPIH---------------EAVKRGHRECMEILLANNVNIDHEVPQL 196

  Fly   203 GEEAY--------DCETGLID 215
            |...|        ||...|::
Human   197 GTPLYVACTYQRVDCVKKLLE 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 6/26 (23%)
ANK 54..169 CDD:238125 31/114 (27%)
Ank_5 67..120 CDD:290568 16/52 (31%)
ANK repeat 81..112 CDD:293786 10/30 (33%)
Ank_5 100..154 CDD:290568 19/53 (36%)
ANK repeat 114..144 CDD:293786 13/29 (45%)
ANK repeat 147..180 CDD:293786 2/32 (6%)
ASB11NP_543149.1 ANK 1 64..93 5/28 (18%)
ANK 66..183 CDD:238125 35/155 (23%)
Ank_4 66..118 CDD:290365 13/68 (19%)
ANK repeat 66..95 CDD:293786 5/40 (13%)
ANK repeat 97..128 CDD:293786 11/35 (31%)
ANK 2 97..126 10/33 (30%)
Ank_2 102..190 CDD:289560 29/109 (27%)
ANK 3 130..159 13/28 (46%)
ANK repeat 130..155 CDD:293786 11/24 (46%)
ANK 4 162..191 4/43 (9%)
ANK 165..280 CDD:238125 8/68 (12%)
ANK repeat 165..193 CDD:293786 3/42 (7%)
Ank_2 167..258 CDD:289560 8/66 (12%)
ANK repeat 195..225 CDD:293786 5/23 (22%)
ANK 5 195..224 5/23 (22%)
ANK repeat 227..258 CDD:293786
ANK 6 227..256
SOCS_ASB_9_11 282..323 CDD:239698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1546307at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.