DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and EMB1135

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_178053.4 Gene:EMB1135 AraportID:AT1G79350 Length:1295 Species:Arabidopsis thaliana

Alignment Length:1395 Identity:502/1396 (36%)
Similarity:748/1396 (54%) Gaps:187/1396 (13%)


  Fly   472 PPPPLAKIPTNLTVERPHSRLSDPKKIESDIDARLQAELDSLPMVAVPADENIEPLGKTDQHFSV 536
            |||||.        .:|||....  .|..|:..|. |....:..|.....|           ||.
plant     8 PPPPLP--------AQPHSAAGG--VIRGDVQVRC-AGCRVILRVKTGVVE-----------FSC 50

  Fly   537 PT--------NKNLSENK-AFPK-PNQVCIPPQP--AIPP--QPAI-------PPAPAYCMANKT 580
            ||        .:.||..: .||: |.|   ||||  .:||  |..:       ||.||:.:....
plant    51 PTCQLPQMLPPELLSRARPQFPQSPQQ---PPQPIQTLPPPIQQQLKPLNLPRPPVPAHGIDPTK 112

  Fly   581 MDTGMSSVVQMANNPLASTQHHALPQVPIVTRLKVDQGEDVSVKFTTGLDGLITNVQLLPSTMAM 645
            |....::...:.|.|      |.|      ||....|                .:|:|       
plant   113 MQLPCANCQAILNVP------HGL------TRFSCPQ----------------CHVEL------- 142

  Fly   646 GQPTVKATEL-ESFTAQQLNMLLQSGHPYLSLPMTNSGVPGAVLQETLQTKDAGFPSEQAVEDEE 709
               .|..::| .|.||.|.:    |..|..:.|.    ||.....|.:        :|:|:|.|.
plant   143 ---AVDVSKLNRSLTASQSH----SNPPTPAAPT----VPPPPPPEEV--------NEEAIEVER 188

  Fly   710 VDYEEIGVADTFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPS--KTTECLSALQL 772
            .:.|.....:||..|.|.||..|..||||:|||::||:|:.|...|.|.:..  :.::.||.||:
plant   189 EEDEGGTAGETFMDYRPPKLSIGPPHPDPIVETSSLSAVQPPEPTYDLKIKEELERSKALSCLQI 253

  Fly   773 EAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAE 837
            |.:|||||.|.|.|..|.||||.:||||||||||||||:|::|:..||::|||:|:.||||:||.
plant   254 ETLVYACQRHLQHLADGTRAGFFVGDGAGVGKGRTIAGLIWENWKHGRRKALWISIGSDLKYDAR 318

  Fly   838 RDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNSKYKTRFRQLTN 902
            |||.|:|| ..:.|..:||..||.:|| :|...|.||:|.||.:||..|    .|.::|.:||..
plant   319 RDLDDVGA-TCVGVNPLNKLPYSKLDS-KNVGIKEGVVFLTYNSLIASS----EKGRSRLQQLVQ 377

  Fly   903 WLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYM 967
            |.|.:|:|:::||||||||||......:.|:.|..|:|:|..:|.|||:|.|||||||||||.||
plant   378 WCGPEFDGLLIFDECHKAKNLVPEAGSQPTRIGQAVVDIQDKIPQARVIYCSATGASEPRNMGYM 442

  Fly   968 VRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSKE 1032
            |||||||.||::.:|.:|:.|::|.|.||:|:||||||.||.|:.|.||:|...|.|.|..:...
plant   443 VRLGLWGAGTSFSDFNKFLGALDKGGTGALELVAMDMKARGMYVCRTLSYKGAEFEIVEARLEAG 507

  Fly  1033 FRKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTR 1097
            ....||.|||.||::..:...|...:..|......:...:|.:|||||::||:::||...|::.:
plant   508 MEAMYNKSAEFWAELRIELLSASAFLPNEKPNSSQLWRLYWSSHQRFFRHLCMSAKVPVTVRLAK 572

  Fly  1098 QATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPKR-------DS 1155
            :|....|.||||||||||:||.|.:.::..:|:.|||..:.::..|||:::|.|::       ||
plant   573 KALSTNKCVVIGLQSTGEARTEEAVNKYGLELDDFVSGPRELLLKFVEENYPLPEQPEPLSEDDS 637

  Fly  1156 F------HHLLNTGEFEPEARSRPPKQKKSKMNTDWVEDDMDAEAGESDIEMYERSCTAAVEKIK 1214
            .      .|..:.|   ...|.|..|..|.|.::| .|.|:::||..:| :..:......:.:|.
plant   638 VKELQRKRHSASPG---VSIRGRVRKMAKWKPDSD-NESDLESEADSAD-DSNDSDDEFQICQIC 697

  Fly  1215 SGQKRRGRPPKADKVEKITMQERIL---------EHLCNNMREQDNEDESTNTSDNTKVKVNITE 1270
            ||:..|.:.....:.:|:...:.::         ..:|.:.:|:..|.....     ::.:...:
plant   698 SGEDERKKLLHCSECDKLFHPDCVVPPVIDLPSEAWICFSCKEKTEEYIQAR-----RLYIAELQ 757

  Fly  1271 RDVERCINMREMLLEKIDVLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVR-TEYDGYKYEP 1334
            :..|..:..:..::|.|..|  .||.|.||.::.:|||...|||||||||.:|| :...|..|:.
plant   758 KRYEAALERKSKIIEIIRSL--NLPNNPLDDIVDQLGGPEKVAEMTGRRGMLVRASNGKGVTYQA 820

  Fly  1335 RCENDSTMDLVNYREKQRFMDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRA 1399
            |...|.||::||..|||.||||.|.|||||||.|:|:|||:|:|..||:||:|:|||||||||||
plant   821 RNTKDITMEMVNMHEKQLFMDGKKLVAIISEAGSAGVSLQADRRAVNQKRRVHLTLELPWSADRA 885

  Fly  1400 IQQFGRTHRSNQVNAPEYVFVITDLAGERRFASTVAKRLESLGALTQGDRRA-TDARDLSQFNID 1463
            ||||||||||||.:||||..:.|:|.|||||||.||||||:||||||||||| .....||.:|.|
plant   886 IQQFGRTHRSNQTSAPEYRLLFTNLGGERRFASIVAKRLETLGALTQGDRRAGPSGPSLSAYNYD 950

  Fly  1464 NSIGRSAL----ENVMQQ-----LTSNKPLDRSQVPQSYKGNFIYDCCVAMAGVGMI------NV 1513
            ::.|:.:|    ..:|:|     |.....:|.   |::.| .|:.....|:..||::      |.
plant   951 SNFGKKSLMVMYRGIMEQEKLPVLPPGCSIDE---PETVK-EFLTKARAALVAVGIVRDSVLANG 1011

  Fly  1514 REENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLD 1578
            ::..:.....::.|.:::.:||||:||...::||.||:.|...:..|:...:..|.||.||:|:.
plant  1012 KDVGRFSGRIIDSDMHDVGRFLNRLLGLPPDIQNRLFELFTSILDVLVHNARIEGSFDSGIVDMK 1076

  Fly  1579 AHGASVKSIKLMRFIRKHATGTAATELHTVTVERGMSFETA---LAKYRKEG-QYEHEGFYILQK 1639
            |:  ||:.:...:.:.......|:|.|.|.|::||:::|:|   |...|::| ...::||:..::
plant  1077 AN--SVELLSTPKTVHVDQMSGASTMLFTFTLDRGVTWESASSMLEGKRRDGLGSANDGFFESKR 1139

  Fly  1640 RRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASISSRYVKVSP-EEAQTYWV 1703
            ....:...||..::.::..        .:|.||..|..:|..:.:.:.::|.|:|. |:|:|.|.
plant  1140 EWLGRRHFILAFESAASGL--------FKIVRPAVGESIREMSLSELKTKYRKLSSLEKARTGWE 1196

  Fly  1704 QQYELCLNMCSHLYWNRTCPMPTGCEVGLRMRTYHVLSGLMLPIWDRIELII---VNSGHK-IQI 1764
            .:||:....|.|   ...|.:...|.||.|::..:|:.||:||||..||..:   ....|| |::
plant  1197 DEYEVSSKQCMH---GPKCKLGEYCTVGRRIQEVNVVGGLILPIWGTIEKALSKQARHSHKRIRV 1258

  Fly  1765 IRMKTDA-NKKIVGTVVPPAVYDDLVADLS 1793
            ||::|.. |::|||..:|.|..:.::.||:
plant  1259 IRIETTTDNQRIVGLSIPNAAVETVLQDLA 1288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 155/303 (51%)
DEXDc 759..986 CDD:214692 121/229 (53%)
Helicase_C_4 1297..1576 CDD:290582 140/296 (47%)
EMB1135NP_178053.4 AAA_34 216..514 CDD:290583 156/304 (51%)
PHD 693..741 CDD:279022 7/48 (15%)
DUF349 739..>791 CDD:281922 11/59 (19%)
Helicase_C_4 782..1074 CDD:290582 140/296 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 836 1.000 Inparanoid score I72
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141580at2759
OrthoInspector 1 1.000 T192914
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 O PTHR12706
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.