DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3491 and SBNO1

DIOPT Version :8

Sequence 1:NP_609731.1 Gene:CG3491 / 34870 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_001161328.1 Gene:SBNO1 / 55206 HGNCID:22973 Length:1393 Species:Homo sapiens

Alignment Length:1402 Identity:630/1403 (45%)
Similarity:834/1403 (59%) Gaps:170/1403 (12%)


  Fly   524 IEPLGKTDQHFSVPTNKNLSENKAF-------------PKPN-QVCIP---------PQPAIP-- 563
            :|| |: |...:..:...:|.|..|             |.|: |..:|         .:.|:|  
Human     2 VEP-GQ-DLLLAALSESGISPNDLFDIDGGDAGLATPMPTPSVQQSVPLSALELGLETEAAVPVK 64

  Fly   564 PQPAIPPAPAYCMANKTMDTGMSSVVQMANN--PLASTQHHALPQVPIVTRLKVDQGEDVSVKFT 626
            .:|...|.||.....:...:..:.|:...|:  ||.||  ..:.:.|.||   .::......|| 
Human    65 QEPETVPTPALLNVRQQPPSTTTFVLNQINHLPPLGST--IVMTKTPPVT---TNRQTITLTKF- 123

  Fly   627 TGLDGLITNVQLLPSTMAMGQPTVK--ATELESFTAQQLNMLLQSG--HPYLSL-PMTNSGVP-- 684
                 :.|.....||..|   |||:  .|...|....||..||::.  :..:.| |..|...|  
Human   124 -----IQTTASTRPSVSA---PTVRNAMTSAPSKDQVQLKDLLKNNSLNELMKLKPPANIAQPVA 180

  Fly   685 --------GAVLQETLQTKDA----------GFPSEQAV-------EDEEVDYEEIGVADTFAAY 724
                    |.|.:|:...:.|          .|.....|       |.||.|.||:|.|:|:|.|
Human   181 TAATDVSNGTVKKESSNKEGARMWINDMKMRSFSPTMKVPVVKEDDEPEEEDEEEMGHAETYAEY 245

  Fly   725 WPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTE--CLSALQLEAVVYACQAHEQILP 787
            .|.|||.|..|||.||||::||||..|::.|:.::..:|.:  .||||||||:.||.|.||..||
Human   246 MPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAITYAAQQHETFLP 310

  Fly   788 SGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVA 852
            :|||||||:||||||||||||||||::|||..||||||.|||:|||:||||||.|||| :.|.|.
Human   311 NGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGA-KNILVH 374

  Fly   853 TINKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNSKYKTRFRQLTNWLGKKFEGVIVFDEC 917
            ::|||||..|.|:.|.:.|:||||.||::|||||. :..|||||.:||.:|.|..|:||||||||
Human   375 SLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ-SGGKYKTRLKQLLHWCGDDFDGVIVFDEC 438

  Fly   918 HKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEF 982
            ||||||..:...|.||||..||:||..||.||||||||||||||||||||.|||:||.||.:.||
Human   439 HKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREF 503

  Fly   983 YEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSKEFRKSYNLSAELWADI 1047
            .:|:.|||:||:||||||||||||||.||||||||..|:|:||||.:|:.:.|.||.:.:||...
Human   504 SDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLSQSYVKMYNKAVKLWVIA 568

  Fly  1048 HKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQS 1112
            .::||:|..|:..|.|::|.:..|||.|||||||.|||||||..||::.|:..:.||.|||||||
Human   569 RERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQS 633

  Fly  1113 TGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPKRDSFHHLLNTGEFEP----EARSRP 1173
            |||:||||.||...|:||.||||||.::||.:|||||||.|...:.||......|    ..|..|
Human   634 TGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPDRKKLYSLLGIDLTAPSNNSSPRDSP 698

  Fly  1174 PKQKKSKMN------------------TDWVEDDMDAEAGESDIEM--YERSCTAAVEKIKSG-- 1216
            .|:.|.|..                  |....||..:|:..||.|.  ||.|     :.:.||  
Human   699 CKENKIKKRKGEEITREAKKARKVGGLTGSSSDDSGSESDASDNEESDYESS-----KNMSSGDD 758

  Fly  1217 ------------------------QKRRGRPPKADKVEKITMQERILEHLCNNMREQ-------- 1249
                                    .|:.....|...::..::|..:|.....:.|..        
Human   759 DDFNPFLDESNEDDENDPWLIRKDHKKNKEKKKKKSIDPDSIQSALLASGLGSKRPSFSSTPVIS 823

  Fly  1250 ---DNEDESTNTSDNTKVKVNITERD-VERCINMREMLLEKIDVLGRKLPPNTLDKLISELGGTN 1310
               ::...::||:.|:.:   ||.:| |||...|::.||:|::.|...|||||||:||.||||..
Human   824 PAPNSTPANSNTNSNSSL---ITSQDAVERAQQMKKDLLDKLEKLAEDLPPNTLDELIDELGGPE 885

  Fly  1311 LVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDLVNYREKQRFMDGSKHVAIISEAASSGISLQS 1375
            .|||||||:||||..:.....||.|.|.|..::::|..||||||||.|::||||||||||||||:
Human   886 NVAEMTGRKGRVVSNDDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQA 950

  Fly  1376 DKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGERRFASTVAKRLES 1440
            |:|..|||||:|:||||||||||||||||||||||||.||||||:|::||||:||||.|||||||
Human   951 DRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLES 1015

  Fly  1441 LGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLDRSQV--PQSYKGNFIYDCCV 1503
            |||||.||||||::||||:||.||..||:|||.||:.:.:   ||...|  |..|.|.|..|...
Human  1016 LGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVN---LDSPMVSPPPDYPGEFFKDVRQ 1077

  Fly  1504 AMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTG 1568
            .:.|||:|||  |::..:.|::||.|||.||||||||..|..|||||::|.|.:.:::...|:.|
Human  1078 GLIGVGLINV--EDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNG 1140

  Fly  1569 RFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERGMSFETALAKYRKEGQYEHEG 1633
            |:|:|||||.:....|:...:.:|:....:.:...||:|::||||||:|.| .|...|.....:|
Human  1141 RYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEA-TKIWAELTGPDDG 1204

  Fly  1634 FYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASISSRYVKVSPEEA 1698
            ||:..:.|.||.:|||.       .:|:..|....:||||||.|::||.:|.:..:|.||..::|
Human  1205 FYLSLQIRNNKKTAILV-------KEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVVSDDA 1262

  Fly  1699 QTYWVQQYELCLNMCSHLYWNRTC---PMPTGCEVGLRMRTYHVLSGLMLPIWDRIELIIVN-SG 1759
            ..:|:.||....:.|:|.||...|   .:...||:|||.|||:||.|.:|.:|.::|.::.: ||
Human  1263 LMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSG 1327

  Fly  1760 H--KIQIIRMKTDANKKIVGTVVPPAVYDDLVADLST 1794
            .  |:||:|::|:..::|||.::|......||..|||
Human  1328 TNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLST 1364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 198/303 (65%)
DEXDc 759..986 CDD:214692 151/229 (66%)
Helicase_C_4 1297..1576 CDD:290582 174/281 (62%)
SBNO1NP_001161328.1 Metaviral_G <26..151 CDD:118131 30/139 (22%)
AAA_34 258..560 CDD:290583 199/304 (65%)
Helicase_C_4 872..1148 CDD:290582 174/281 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 O PTHR12706
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.