DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and sno

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_001096967.1 Gene:sno FlyBaseID:FBgn0265630 Length:1653 Species:Drosophila melanogaster

Alignment Length:1777 Identity:744/1778 (42%)
Similarity:969/1778 (54%) Gaps:376/1778 (21%)


  Fly   247 NF--DSKSSDLEEAEEK----------------TYLKRQSERNFYSGYRSESEGTNITPAKRSKA 293
            ||  |...||.::.|:.                ||     .:|..||.....:|....|...:|.
  Fly    18 NFDEDDSGSDFDDDEDPDQIEVPGGGRDLNTAVTY-----AQNIRSGVGVAPKGGIPIPISGAKI 77

  Fly   294 QI--NSIPKLEYSTTYGQAQNLVVSENANITQKPSSDIKSRYRSTEYNQINKPDSQQPINYAHQK 356
            .:  |.|..:..........|:|.|.|    .:.:::|.|...|:..|                 
  Fly    78 VVGNNKIKPISLLRINNNNNNIVTSVN----NRNNNNIISTNGSSNNN----------------- 121

  Fly   357 EETIDRRREMHMRKEHQYVDNHLNNPAQNKPDRTVSFLEMLSQAEAKKESNQGAKKPTV------ 415
                               :|.:||.:|.....||:          ...:..|| .|||      
  Fly   122 -------------------NNSINNNSQIIKTTTVT----------TTPTTVGA-TPTVGGVALG 156

  Fly   416 ----------------NKVSNVSQYLIDLGFTAGSPNHDSNSNDG--NDEQDNIDRRLNADLDSL 462
                            |.:||:.:.|.::....|||...|:.|.|  ...|.......::.|:||
  Fly   157 GKLTVIPIAGRNVALDNNLSNMPKKLNNMVTAMGSPAARSSGNAGTTGSSQGGAIGSTSSYLNSL 221

  Fly   463 FTTDEL-------------ACPPPPPLAKIPTNLTVERPHSRLSDP---------------KKIE 499
             ||:||             |.|||||  ....|.....|...:.:|               ....
  Fly   222 -TTNELMNLAAYVAAKGSNAPPPPPP--STAANSVRHSPTGGIPNPGGNFFGGSAAASTSASAAN 283

  Fly   500 SDIDARLQAELD----SLPMVAVPADENIEPLGKTDQHFSVPTNKNLSENKAFPKPNQVCIPPQP 560
            .::.|.|.|::.    :..:.|:....||..:|...:                        ||..
  Fly   284 FNMAASLLAQMSYAGGASQIRALKVAGNIGGVGNNQK------------------------PPPI 324

  Fly   561 AIPPQPAIPPAPAYCMANKTMDTGMSSVVQM-ANNPLASTQHHALPQVPIVTRLKVDQGEDVSVK 624
            |..|....|...|.....|..::.|.:|.:: |.||                           ..
  Fly   325 ATTPGSGGPAGGAPGSGVKGNNSMMEAVQKLIAMNP---------------------------EY 362

  Fly   625 FTTGLDGLITNVQLLPSTMAMGQPTVKATELESFTAQQLNMLLQSGHPYLSLPMTNSGVPGAVLQ 689
            .|:|:..  |..|:...:|...|.|                      |..:.||.    |||:: 
  Fly   363 LTSGIPN--TVFQMFMQSMQRPQAT----------------------PSPNQPMN----PGAMV- 398

  Fly   690 ETLQTKDAGFPSEQAV---EDEEVDYEEIGVADTFAAYWPSKLKFGRAHPDPVVETATLSSVELP 751
             |.....|...|..|.   |::||||||:|||:|:|.|||:|||.|:.|||.|||||:|||||..
  Fly   399 -TSAAAAAAHASAVAYVQQEEDEVDYEEMGVAETYADYWPAKLKLGKKHPDAVVETASLSSVEPC 462

  Fly   752 NINYQLALPSKTTEC--LSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFD 814
            ::.|:|:||.:|...  |||||||::.||.|||:.:||.|.|||||:||||||||||||||||::
  Fly   463 DVYYKLSLPLETINSGHLSALQLESITYASQAHDHLLPDGSRAGFLIGDGAGVGKGRTIAGIIYE 527

  Fly   815 NYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTY 879
            |||||||:|||:|||:|||:||||||:|||| .:|.|..:|||||:.|.|:.|.|.||||||.||
  Fly   528 NYLKGRKKALWISVSNDLKYDAERDLSDIGA-TRIEVHALNKFKYAKISSDVNNNCKRGVIFSTY 591

  Fly   880 TALIGESMTTNSKYKTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKL 944
            :||||||.....||::|||||..|.|:.|||:|:||||||||||..:..||.||||.|||:||:.
  Fly   592 SALIGESNNKTGKYRSRFRQLLQWCGEDFEGLIIFDECHKAKNLCPVGSGKPTKTGQTVLELQQK 656

  Fly   945 LPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGT 1009
            ||.||||||||||||||:||||||||||||.|||:..|.:|:.|||:||:||||||||||||||.
  Fly   657 LPKARVVYASATGASEPKNMAYMVRLGLWGQGTAFGNFNDFITAVERRGVGAMEIVAMDMKLRGM 721

  Fly  1010 YIARQLSFKDVSFRIEEVNMSKEFRKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQFWC 1074
            |||||||||.|||:||||.:||||||.|:.|.|||.:..:||.:|..|:..|:|::|.:..|||.
  Fly   722 YIARQLSFKGVSFKIEEVPLSKEFRKIYDQSVELWVEAMQKFTEAAELIDAESRMKKTMWGQFWS 786

  Fly  1075 AHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMI 1139
            :||||||.||||:||||.|.:.|::.:.||.||||||||||:|||:.|||..|:|..||||||.:
  Fly   787 SHQRFFKYLCIAAKVNHAVLVARESIKYGKCVVIGLQSTGEARTLDQLERDDGELTDFVSTAKGV 851

  Fly  1140 IQSFVEKHFPAPKRDSFHHLLNTGEFEPEARS-----------------------------RPPK 1175
            .|||||:|||||.|:..:.:|...:..|...|                             |..|
  Fly   852 FQSFVERHFPAPDRNRINRILGLYDETPSLSSVADSTSSLSNNSNITTAAGKRKGSNNNDNRSTK 916

  Fly  1176 QKKSKMNTDW-----------------------------------VEDDMDAEAGESDIEMYERS 1205
            .||.|.:..|                                   ::.|:|.|..:.|::..:||
  Fly   917 IKKKKRSGSWECSDSEDENTDMKRNRKRDGGNSNSDSDEANSDDDLKSDIDDEDEDHDVDSDQRS 981

  Fly  1206 -----------------------CTAAVEKIKSGQKRRGRPPKADKVEK---------------- 1231
                                   ..|..:|.|..||:..:..|.:|.:|                
  Fly   982 VASDASSDFNPFFSGSDSDIDPWVNARSKKSKKAQKKSKKKVKKEKTKKEITTSSATDPSGSTAM 1046

  Fly  1232 -----------------ITMQERILEHLCNNMREQDNEDESTNTSDNTKVKVNI--TERD-VERC 1276
                             ::.|::|.:.|   .::|:.:...|....| .||:|.  ..:| :||.
  Fly  1047 SATVVAALNAVKNRKSQLSTQDKIQDLL---QKKQELKGTVTPVGVN-GVKLNYGPPPKDAIERA 1107

  Fly  1277 INMREMLLEKIDVLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDST 1341
            ..|:|.||.||:.||.:|||||||:||.||||.:.||||||||||||:|:....:||.|.|:|..
  Fly  1108 CTMKEELLRKIERLGARLPPNTLDQLIDELGGPDNVAEMTGRRGRVVQTDDGSIQYESRTESDVP 1172

  Fly  1342 MDLVNYREKQRFMDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRT 1406
            ::.:|..||||||||.|.|||||||||||||||||:||.|||||:||||||||||||||||||||
  Fly  1173 LETLNITEKQRFMDGEKDVAIISEAASSGISLQSDRRVFNQRRRVHITLELPWSADRAIQQFGRT 1237

  Fly  1407 HRSNQVNAPEYVFVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSAL 1471
            |||||||||||:|:|:|||||||||||||||||||||||.||||||:.||||||||||..||.||
  Fly  1238 HRSNQVNAPEYIFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKYGRQAL 1302

  Fly  1472 ENVMQQLTS-NKPLDRSQVPQSYKGNFIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFL 1535
            |.||:.:.. ..||  ...|..|.|.|..|...|:.|||:| |..|:...|.:::||.|||||||
  Fly  1303 ETVMRTIMGYESPL--VPPPTDYSGEFFKDIAGALVGVGII-VNSESHPGVLSLDKDYNNISKFL 1364

  Fly  1536 NRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGT 1600
            ||||||.|::||.|||:|.|.|.::|.|.||.||||||||||.|.|.:|..::|:||:||||||.
  Fly  1365 NRILGCPVDLQNRLFKYFTDTMTAIIQQAKRGGRFDLGILDLGAAGENVTRVRLIRFVRKHATGV 1429

  Fly  1601 AATELHTVTVERGMSFETALAKYRKEGQYEHEGFYILQKRRQNKNSAILCL-------QAPSNSS 1658
            |.||:|||.|||||.::.|:.|| .:...|:||||:..:.|..|.:||:.:       .:.|:::
  Fly  1430 APTEMHTVRVERGMIWQEAIDKY-ADLFNENEGFYLSHQLRNQKRTAIMVVILESRNSSSTSSTT 1493

  Fly  1659 DVSNG----------KINLQIYRPNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMC 1713
            |:.:|          :|..||||||||.|||.|:...:..:|.||:.|||:.:|.:||:..:|.|
  Fly  1494 DLDSGSKKKKTHSKKEIMCQIYRPNTGLQVRHESLFELEKKYRKVASEEAEPHWTEQYDASVNTC 1558

  Fly  1714 SHLYWNRTC---PMPTGCEVGLRMRTYHVLSGLMLPIWDRIELII-VNSGHKIQIIRMKTDANKK 1774
            ||.|||..|   .:...||||||.|.||||:|.:|.:|.|:|.|: ..|..|:|:|||||...:|
  Fly  1559 SHAYWNGNCRNVSLGNDCEVGLRQRLYHVLAGSVLSVWGRVEHILNTRSNSKMQVIRMKTTEGEK 1623

  Fly  1775 IVGTVVPPAVYDDLVADLSTDS 1796
            ||||::|.:.::.|||||.:||
  Fly  1624 IVGTLIPKSCFEPLVADLRSDS 1645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 212/303 (70%)
DEXDc 759..986 CDD:214692 157/229 (69%)
Helicase_C_4 1297..1576 CDD:290582 192/280 (69%)
snoNP_001096967.1 AAA_34 448..751 CDD:290583 212/304 (70%)
Helicase_C_4 1128..1405 CDD:290582 192/280 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133411145
eggNOG 1 0.900 E1_KOG1513
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 836 1.000 Inparanoid score I72
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 P PTHR12706
RoundUp 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.