DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and Sbno2

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:XP_006240970.1 Gene:Sbno2 RGDID:1307194 Length:1351 Species:Rattus norvegicus

Alignment Length:1305 Identity:566/1306 (43%)
Similarity:747/1306 (57%) Gaps:171/1306 (13%)


  Fly   557 PPQPAIPPQPAI----------------PPA-PAYCMANKTMDTGMSSVVQMANNPLASTQHHAL 604
            ||....||...|                ||. |.:...|:..   :||...:.......|.:...
  Rat    13 PPHELPPPGGGIQLQNRLLHCPWWGSFSPPLYPTFSSENQQF---VSSTPFLGGQSCPETSYPTT 74

  Fly   605 PQVPIVTRLKVDQGEDVSV--------KFTTGLDGLI---TNVQLLPSTMAMGQPTVKATELESF 658
            ..||.......|..:|.|.        .|::.:|.|.   .....||:......||:......|.
  Rat    75 ATVPSFFSKSSDFPQDPSCLEDLSNASVFSSSVDSLSDIPDTPDFLPADSLNEVPTIWDVSTTST 139

  Fly   659 TAQQLNMLLQSGHPYLSLPMTNSGVPGAVLQETLQTKDAGFPSEQAVEDEEVDYEEIGVADTFAA 723
            |..:|.:   ...|:.:|....:.|....|..:.|:...  |.|:..|||| :.||:|.|:|:|.
  Rat   140 TRDKLFL---PSVPFSALEDPVTAVSSTPLLVSYQSHSQ--PEEEEGEDEE-EAEELGHAETYAD 198

  Fly   724 YWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTECLSALQLEAVVYACQAHEQILPS 788
            |.|||.|.|:.|||.||||:|||||..|:|.|.||||:.....||||||||:.||||.||.:|||
  Rat   199 YVPSKSKIGKQHPDRVVETSTLSSVPPPDITYTLALPTSDNGTLSALQLEAITYACQQHEVLLPS 263

  Fly   789 GDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVAT 853
            |.|||||:|||||||||||:||||.:|||:|||:|||.|.|:|||:||||||.||.| ..|.|..
  Rat   264 GQRAGFLIGDGAGVGKGRTVAGIIVENYLRGRKKALWFSASNDLKYDAERDLRDIEA-PGIAVHA 327

  Fly   854 INKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNSKYKTRFRQLTNWLGKKFEGVIVFDECH 918
            ::|.||.  |:..:|    ||:|.||:||||||. ...:::||.||:..|.|:.|:|||||||||
  Rat   328 LSKIKYG--DNTTSE----GVLFATYSALIGESQ-AGGQHRTRLRQILQWCGEAFDGVIVFDECH 385

  Fly   919 KAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFY 983
            ||||.|      |||.|..|||||..||.|||||||||||||||||.||.|||:||.||.:..|.
  Rat   386 KAKNAS------STKMGKAVLDLQNKLPQARVVYASATGASEPRNMIYMSRLGIWGEGTPFRTFE 444

  Fly   984 EFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSKEFRKSYNLSAELWADIH 1048
            ||::|:||||:|||||||||||:.|.||||||||..|:|||||:.:|..|.:.||.:|.|||:..
  Rat   445 EFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVTFRIEEIPLSPVFEQVYNRAARLWAEAL 509

  Fly  1049 KKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQST 1113
            ..||:|...:.:|:|  |.:..|||.|||||||.||||:||:.:|::.:|.....|.||||||||
  Rat   510 SVFQQAADWIGLESR--KSLWGQFWSAHQRFFKYLCIAAKVHRLVELAQQELSRDKCVVIGLQST 572

  Fly  1114 GESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPKRDSFHHLLNTGEFEPEARSRPPKQKK 1178
            ||:||.|.|:.:.|:|:.|||.|:.:..|.::||||:.:|               .|.|...::|
  Rat   573 GEARTREVLDENEGRLDCFVSAAEGVFLSLIQKHFPSTRR---------------RRDRGGGKRK 622

  Fly  1179 SKMNTDWVEDDMDAEAGESDIEMYERSCTAAVEKIKSGQKRRGRPPKADKVEKITMQE----RIL 1239
                                                  ::.|||.|||   .::|::.    ||.
  Rat   623 --------------------------------------RRPRGRGPKA---SRLTLEAAGVIRIS 646

  Fly  1240 EHLCNNMREQD-NEDESTNTSDNTKVKVNIT------------------ERD------VERCINM 1279
            :   .:..|.| ..|...|:|..:.|..::.                  :||      :||...:
  Rat   647 D---GSSTESDAGLDSDFNSSPESLVDDDVVIVDAPTLPTDDRGPLYPLQRDLQGPGVLERVERL 708

  Fly  1280 REMLLEKIDVLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDL 1344
            ::.||.|:..|||:||.||||:||.:|||...|||||||:||||........:|.|.|...::|.
  Rat   709 KQGLLAKVRALGRELPVNTLDQLIHQLGGPECVAEMTGRKGRVVSRPDGSVVFESRAEQGLSIDH 773

  Fly  1345 VNYREKQRFMDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRS 1409
            ||.|||||||.|.|.|||||||:|||:|||:|:||.|||||:|:|||||||||||||||||||||
  Rat   774 VNLREKQRFMSGEKLVAIISEASSSGVSLQADRRVQNQRRRVHMTLELPWSADRAIQQFGRTHRS 838

  Fly  1410 NQVNAPEYVFVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENV 1474
            |||:||||||:|::|||||||||.||||||||||||.||||||::||||::|.:|..|..||..|
  Rat   839 NQVSAPEYVFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGARALSRV 903

  Fly  1475 MQQL---TSNKPLDRSQVPQSYKGN---FIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISK 1533
            :..:   |:|    |..:||.|.|.   |..|....:..||:.:  .|::.....||||. :|:|
  Rat   904 LATIMGQTNN----RVPLPQGYPGGDAAFFRDMKQGLLSVGIGS--RESRSGCLDVEKDC-SITK 961

  Fly  1534 FLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHAT 1598
            |||||||..|..|||||::|.|....||...|:.||:|:|||||......:.......|:.....
  Rat   962 FLNRILGLEVHKQNALFQYFSDTFDHLIEIDKKEGRYDMGILDLAPGINEIHEESQQVFLAPGHP 1026

  Fly  1599 GTAATELHTVTVERGMSFETALAK-YRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSN 1662
            .......:.::|:|||.:|.|..: ...:|.|  :|||:..|.|.:|.|   ||.|..|..|.  
  Rat  1027 QDGQVVFYKISVDRGMKWEEAFTRSLELKGPY--DGFYLSYKVRGSKTS---CLLAEQNRGDY-- 1084

  Fly  1663 GKINLQIYRPNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTCPMPTG 1727
                ..:|:||.|.|.:|||..::..::.:|:||||:..|...|.|.|..|||..||:.|.:...
  Rat  1085 ----FTVYKPNIGRQSQLETLDNLCRKFHRVTPEEAREPWESSYALSLEHCSHTTWNQRCRLAQE 1145

  Fly  1728 ---CEVGLRMRTYHVLSGLMLPIWDRIELII--VNSGHKIQIIRMKTDANKKIVGTVVPPAVYDD 1787
               |..|||:|.:::|.|.:|.:|.||..::  |:|...:||:|:||...||.||..:|......
  Rat  1146 GKCCAQGLRLRHHYMLCGALLRVWGRIAAVMADVSSSSYLQIVRLKTKDKKKQVGIKIPEGCVHR 1210

  Fly  1788 LVADL 1792
            ::.:|
  Rat  1211 VLQEL 1215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 191/301 (63%)
DEXDc 759..986 CDD:214692 142/227 (63%)
Helicase_C_4 1297..1576 CDD:290582 167/285 (59%)
Sbno2XP_006240970.1 AAA_34 212..500 CDD:290583 192/302 (64%)
Helicase_C_4 726..1004 CDD:290582 167/285 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2398753
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1044 1.000 Inparanoid score I241
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 1 1.000 FOG0005700
OrthoInspector 1 1.000 T618487
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12706
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.