DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and Sbno1

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:XP_006249362.1 Gene:Sbno1 RGDID:1310005 Length:1392 Species:Rattus norvegicus

Alignment Length:1422 Identity:622/1423 (44%)
Similarity:833/1423 (59%) Gaps:166/1423 (12%)


  Fly   460 DSLFTTD----ELACPPPP------PLAKIPTNLTVERPHSRLSDPKKIESDIDARLQAELDSLP 514
            :.||..|    .||.|.||      ||:.:...|..|.......:|:.:.:.....::.:..|..
  Rat    21 NDLFDVDGGDAGLATPTPPSVQQSVPLSALELGLETEAAIPVKQEPEMMSTPALLNVRQQPPSTT 85

  Fly   515 MVAVPADENIEPLGKTDQHFSVP---TNKNLSENKAFPKPNQVCIPPQPAIPPQPAIPPAPAYCM 576
            ...:.....:..||.|......|   ||:.......|.:......|...|...:.|||||||   
  Rat    86 TFVLNQINQLPTLGSTIVMTKTPPATTNRQTITLTKFIQTTANTRPSVSAPAVRNAIPPAPA--- 147

  Fly   577 ANKTMDTGMSSVVQMAN-------NPLASTQHHALPQVPIVTRLKVDQGEDVSVKFTTGLDGLIT 634
                     ...||:.:       |.|...:..|....|:.|     ...|||       :|.:.
  Rat   148 ---------KDQVQLKDLLKNNSLNELMKLKPPANIAQPVAT-----AATDVS-------NGAVK 191

  Fly   635 NVQLLPSTMAMGQPTVKATELESFTAQQLNMLLQSGHPYLSLPMTNSGVPGAVLQETLQTKDAGF 699
            ...   |...:.:..:...::.||:            |.:.:|:             ::.:|   
  Rat   192 KES---SNKEVARVWINDMKMRSFS------------PTMKVPV-------------VREED--- 225

  Fly   700 PSEQAVEDEEVDYEEIGVADTFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTT 764
                  |.||.|.||:|.|:|:|.|.|.|||.|..|||.||||::||||..|::.|:.::..:|.
  Rat   226 ------EPEEEDEEEMGHAETYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETI 284

  Fly   765 E--CLSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVS 827
            :  .|||||||||.||.|.||..||:|||||||:||||||||||||||||::|||..||||||.|
  Rat   285 DNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFS 349

  Fly   828 VSSDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNSK 892
            ||:|||:||||||.|||| :.|.|.::|||||..|.|:.|.:.|:||||.||::|||||. :..|
  Rat   350 VSNDLKYDAERDLRDIGA-KNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ-SGGK 412

  Fly   893 YKTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATG 957
            ||||.:||.:|.|..|:||||||||||||||..:...|.||||..||:||..||.||||||||||
  Rat   413 YKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATG 477

  Fly   958 ASEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSF 1022
            ||||||||||.|||:||.||.:.||.:|:.|||:||:||||||||||||||.||||||||..|:|
  Rat   478 ASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTF 542

  Fly  1023 RIEEVNMSKEFRKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIAS 1087
            :||||.:|:.:.|.||.:.:||....::||:|..|:..|.|::|.:..|||.|||||||.|||||
  Rat   543 KIEEVLLSQSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIAS 607

  Fly  1088 KVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPK 1152
            ||..||::.|:..:.||.||||||||||:||||.||...|:||.||||||.::||.:|||||||.
  Rat   608 KVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 672

  Fly  1153 RDSFHHLLNTGEFEPEARSRP-------------------PKQKKSKMNTDWVEDDMDAEAGESD 1198
            |...:.||......|...|.|                   .:.||::..........|....|||
  Rat   673 RKKLYSLLGIDLTAPSNNSSPRDSPCKENKIKKRKGEEITREAKKARKIGGLTGSSSDDSGSESD 737

  Fly  1199 IEMYERSCTAAVEKIKSGQK---------------------RRGRPPKADK-----VEKITMQER 1237
            :...|.|...:.:.:.||..                     |:......||     ::..::|..
  Rat   738 VSDNEESDYESSKNMSSGDDDDFNPFRDESSEDNEDDPWLIRKDHKKSKDKKKKKSIDPDSIQSA 802

  Fly  1238 ILEHLCNNMR-----------EQDNEDESTNTSDNTKVKVNITERD-VERCINMREMLLEKIDVL 1290
            :|.....:.|           ..::...::|::.|:.:   ||.:| |||...|::.||:|::.|
  Rat   803 LLASGLGSKRPSFSSAPVISPASNSAPANSNSNSNSSL---ITSQDAVERAQQMKKDLLDKLEKL 864

  Fly  1291 GRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDLVNYREKQRFMD 1355
            ...|||||||:||.||||...|||||||:||||..:.....||.|.|.|..::::|..|||||||
  Rat   865 AEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSNDDGSISYESRSELDVPVEILNITEKQRFMD 929

  Fly  1356 GSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFV 1420
            |.|::||||||||||||||:|:|..|||||:|:||||||||||||||||||||||||.||||||:
  Rat   930 GDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFL 994

  Fly  1421 ITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLD 1485
            |::||||:||||.||||||||||||.||||||::||||:||.||..||:|||.||:.:.:   ||
  Rat   995 ISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVN---LD 1056

  Fly  1486 RSQV--PQSYKGNFIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNA 1548
            ...|  |..|.|.|..|....:.|||:|||  |::..:.|::||.|||.||||||||..|..|||
  Rat  1057 SPMVSPPPDYPGEFFKDVRQGLIGVGLINV--EDRSGILTLDKDYNNIGKFLNRILGMEVHQQNA 1119

  Fly  1549 LFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERG 1613
            ||::|.|.:.:::...|:.||:|:|||||.:....|:...:.:|:....:.:...||:|::||||
  Rat  1120 LFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERG 1184

  Fly  1614 MSFETALAKYRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQV 1678
            ||::.| .|...|.....:|||:..:.|.||.:|||.       .:|:..|....|||||||.|:
  Rat  1185 MSWDEA-TKIWAELTGPDDGFYLSLQIRNNKKTAILV-------KEVNPKKKLFLIYRPNTGKQL 1241

  Fly  1679 RLETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTC---PMPTGCEVGLRMRTYHVL 1740
            :||.:|.:..:|.||..::|..:|:.||....:.|:|.||...|   .:...||:|||.|||:||
  Rat  1242 KLEIYADLKKKYKKVVSDDALVHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVL 1306

  Fly  1741 SGLMLPIWDRIELIIVN-SGH--KIQIIRMKTDANKKIVGTVVPPAVYDDLVADLST 1794
            .|.:|.:|.::|.::.: ||.  |:||:|::|:..::|||.::|......||..|||
  Rat  1307 CGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLST 1363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 199/303 (66%)
DEXDc 759..986 CDD:214692 152/229 (66%)
Helicase_C_4 1297..1576 CDD:290582 174/281 (62%)
Sbno1XP_006249362.1 AAA_34 257..559 CDD:290583 200/304 (66%)
Helicase_C_4 871..1147 CDD:290582 174/281 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1044 1.000 Inparanoid score I241
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T618487
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12706
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.