DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and Sbno1

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_001074672.1 Gene:Sbno1 MGIID:2384298 Length:1391 Species:Mus musculus

Alignment Length:1442 Identity:626/1443 (43%)
Similarity:831/1443 (58%) Gaps:207/1443 (14%)


  Fly   460 DSLFTTD----ELACPPPP------PLAKIPTNLTVERPHSRLSDPKKIESDIDARLQAELDSLP 514
            :.||..|    .||.|.||      ||:.:...|..|                            
Mouse    21 NDLFDVDGGDAGLATPTPPSVQQSVPLSALELGLETE---------------------------- 57

  Fly   515 MVAVPADENIEPLGKTDQHFSVPTNKNLSENKAFPKPNQVCIPPQPAIPPQPAIPPAPAYCMANK 579
             .|||..:..||:       |.|...|:.:.                       ||:....:.|:
Mouse    58 -AAVPVKQEPEPM-------STPALLNVRQQ-----------------------PPSTTTFVLNQ 91

  Fly   580 --TMDTGMSSVVQMANNPLASTQHHALPQVPIVTRLKVDQGEDVSVKFTTGLDGLITNVQLLPST 642
              .:.| :.|.:.|...|.|:|....      :|..|..|                |.....||.
Mouse    92 INQLPT-LGSTIVMTKTPPATTNRQT------ITLTKFIQ----------------TTANTRPSV 133

  Fly   643 MA-------MGQPTVKATELESFTA-QQLNMLLQSGHP-YLSLPMTNSGVP---GAVLQETLQTK 695
            .|       ...|:....:|:.... ..||.|::...| .::.|:..:...   |||.:|:...:
Mouse   134 SAPAVRNAMPAAPSKDQVQLKDLLKNNSLNELMKLKPPANIAQPVATAATDVSNGAVKKESSNKE 198

  Fly   696 DA----------GFPSEQAV-------EDEEVDYEEIGVADTFAAYWPSKLKFGRAHPDPVVETA 743
            .|          .|.....|       |.||.|.||:|.|:|:|.|.|.|||.|..|||.||||:
Mouse   199 VARIWINDMKMRSFSPTMKVPVVKEEDEPEEEDEEEMGHAETYAEYMPIKLKIGLRHPDAVVETS 263

  Fly   744 TLSSVELPNINYQLALPSKTTE--CLSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGR 806
            :||||..|::.|:.::..:|.:  .|||||||||.||.|.||..||:|||||||:||||||||||
Mouse   264 SLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGR 328

  Fly   807 TIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENFK 871
            ||||||::|||..||||||.|||:|||:||||||.|||| :.|.|.::|||||..|.|:.|.:.|
Mouse   329 TIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGA-KNILVHSLNKFKYGKISSKHNGSVK 392

  Fly   872 RGVIFCTYTALIGESMTTNSKYKTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGT 936
            :||||.||::|||||. :..|||||.:||.:|.|..|:||||||||||||||..:...|.||||.
Mouse   393 KGVIFATYSSLIGESQ-SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGL 456

  Fly   937 TVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVA 1001
            .||:||..||.||||||||||||||||||||.|||:||.||.:.||.:|:.|||:||:|||||||
Mouse   457 AVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVA 521

  Fly  1002 MDMKLRGTYIARQLSFKDVSFRIEEVNMSKEFRKSYNLSAELWADIHKKFQKACRLMCVENRVQK 1066
            |||||||.||||||||..|:|:||||.:|:.:.|.||.:.:||....::||:|..|:..|.|::|
Mouse   522 MDMKLRGMYIARQLSFTGVTFKIEEVLLSQSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKK 586

  Fly  1067 IITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNS 1131
            .:..|||.|||||||.|||||||..||::.|:..:.||.||||||||||:||||.||...|:||.
Mouse   587 SMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELND 651

  Fly  1132 FVSTAKMIIQSFVEKHFPAPKRDSFHHLLNTGEFEP----EARSRPPKQKKSKMN---------- 1182
            ||||||.::||.:|||||||.|...:.||......|    ..|..|.|:.|.|..          
Mouse   652 FVSTAKGVLQSLIEKHFPAPDRKKLYSLLGIDLTAPSNNSSPRDSPCKENKIKKRKGEEITREAK 716

  Fly  1183 --------TDWVEDDMDAEA----GESDIEMYERSCTAAVEK------------------IKSGQ 1217
                    |....||..:|:    .|||.|..:...:...:.                  |:...
Mouse   717 KARKVGGLTGSSSDDSGSESVSDNDESDYESSKNMSSGDDDDFNPFRDESSEDNEDDPWLIRKDH 781

  Fly  1218 KRRGRPPKADKVEKITMQERILEHLCNNMR-----------EQDNEDESTNTSDNTKVKVNITER 1271
            |:.....|...::..::|..:|.....:.|           ..::...::|::.|:.:   :|.:
Mouse   782 KKSKDKKKKKSIDPDSIQSALLASGLGSKRPSFSSAPVISPASNSAPANSNSNSNSSL---VTSQ 843

  Fly  1272 D-VERCINMREMLLEKIDVLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPR 1335
            | |||...|::.||:|::.|...|||||||:||.||||...|||||||:||||..:.....||.|
Mouse   844 DAVERAQQMKKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSNDDGSISYESR 908

  Fly  1336 CENDSTMDLVNYREKQRFMDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAI 1400
            .|.|..::::|..||||||||.|::||||||||||||||:|:|..|||||:|:||||||||||||
Mouse   909 SELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAI 973

  Fly  1401 QQFGRTHRSNQVNAPEYVFVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNS 1465
            ||||||||||||.||||||:|::||||:||||.||||||||||||.||||||::||||:||.||.
Mouse   974 QQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNK 1038

  Fly  1466 IGRSALENVMQQLTSNKPLDRSQV--PQSYKGNFIYDCCVAMAGVGMINVREENKVKVFTVEKDS 1528
            .||:|||.||:.:.:   ||...|  |..|.|.|..|....:.|||:|||  |::..:.|::||.
Mouse  1039 YGRNALEIVMKSIVN---LDSPMVSPPPDYPGEFFKDVRQGLIGVGLINV--EDRSGILTLDKDY 1098

  Fly  1529 NNISKFLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFI 1593
            |||.||||||||..|..|||||::|.|.:.:::...|:.||:|:|||||.:....|:...:.:|:
Mouse  1099 NNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFL 1163

  Fly  1594 RKHATGTAATELHTVTVERGMSFETALAKYRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSS 1658
            ....:.:...||:|::||||||:|.| .|...|.....:|||:..:.|.||.:|||.       .
Mouse  1164 TPGYSTSGHVELYTISVERGMSWEEA-TKIWAELTGPDDGFYLSLQIRNNKKTAILV-------K 1220

  Fly  1659 DVSNGKINLQIYRPNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTC- 1722
            :|:..|....|||||||.|::||.:|.:..:|.||..::|..:|:.||....:.|:|.||...| 
Mouse  1221 EVNPKKKLFLIYRPNTGKQLKLEIYADLKKKYKKVVSDDALVHWLDQYNSSADTCTHAYWRGNCK 1285

  Fly  1723 --PMPTGCEVGLRMRTYHVLSGLMLPIWDRIELIIVN-SGH--KIQIIRMKTDANKKIVGTVVPP 1782
              .:...||:|||.|||:||.|.:|.:|.::|.::.: ||.  |:||:|::|:..::|||.::|.
Mouse  1286 KASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPA 1350

  Fly  1783 AVYDDLVADLST 1794
            .....||..|||
Mouse  1351 NCVSPLVNLLST 1362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 199/303 (66%)
DEXDc 759..986 CDD:214692 152/229 (66%)
Helicase_C_4 1297..1576 CDD:290582 174/281 (62%)
Sbno1NP_001074672.1 AAA_34 257..559 CDD:316395 200/304 (66%)
Helicase_C_4 870..1146 CDD:316394 174/281 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 O PTHR12706
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.770

Return to query results.
Submit another query.