DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and SBNO2

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_055778.2 Gene:SBNO2 HGNCID:29158 Length:1366 Species:Homo sapiens

Alignment Length:1333 Identity:570/1334 (43%)
Similarity:757/1334 (57%) Gaps:189/1334 (14%)


  Fly   515 MVAV-PADENIEPLGKTDQHFSVPTNKNLSENKAFPKPNQVCIPPQPAIPPQP-----AIPPAPA 573
            |:|| ||.:...|     ||...|....|     :..|     |.|.|:...|     ::||.||
Human     1 MLAVGPAMDRDYP-----QHEPPPAGSLL-----YSPP-----PLQSAMLHCPYWNTFSLPPYPA 50

  Fly   574 YCMANKTMDTGMSSVVQMANNPLASTQHHALPQVPIVTRLKV-----DQGED---------VSVK 624
            :...::..   |||...:.:.|...|.:     .|:.|...:     |..:|         :|: 
Human    51 FSSDSRPF---MSSASFLGSQPCPDTSY-----APVATASSLPPKTCDFAQDSSYFEDFSNISI- 106

  Fly   625 FTTGLDGL---ITNVQLLP-------STMAMGQPTVKATELESFTAQQLNMLLQSGHPYLS---- 675
            |::.:|.|   :.....||       ||:....|.....:          .|.|...|:..    
Human   107 FSSSVDSLSDIVDTPDFLPADSLNQVSTIWDDNPAPSTHD----------KLFQLSRPFAGFEDF 161

  Fly   676 LPMTNSGVPGAVLQETLQTKDAGFPSEQAVEDEEVDYEEIGVADTFAAYWPSKLKFGRAHPDPVV 740
            ||..::.:..:..::::|::    |.|:. |.||.:.||:|..:|:|.|.|||.|.|:.|||.||
Human   162 LPSHSTPLLVSYQEQSVQSQ----PEEED-EAEEEEAEELGHTETYADYVPSKSKIGKQHPDRVV 221

  Fly   741 ETATLSSVELPNINYQLALPSKTTECLSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKG 805
            ||:|||||..|:|.|.||||| .:..||||||||:.||||.||.:||||.|||||:|||||||||
Human   222 ETSTLSSVPPPDITYTLALPS-DSGALSALQLEAITYACQQHEVLLPSGQRAGFLIGDGAGVGKG 285

  Fly   806 RTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENF 870
            ||:||:|.:|:|:|||:|||.|||:|||:||||||.||.| ..|.|..::|.||....:.|    
Human   286 RTVAGVILENHLRGRKKALWFSVSNDLKYDAERDLRDIEA-TGIAVHALSKIKYGDTTTSE---- 345

  Fly   871 KRGVIFCTYTALIGESMTTNSKYKTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTG 935
              ||:|.||:||||||. ...:::||.||:.:|.|:.|||||||||||||||..      |||.|
Human   346 --GVLFATYSALIGESQ-AGGQHRTRLRQILDWCGEAFEGVIVFDECHKAKNAG------STKMG 401

  Fly   936 TTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIV 1000
            ..|||||..||.|||||||||||||||||.||.|||:||.||.:..|.||::|:||||:||||||
Human   402 KAVLDLQNKLPLARVVYASATGASEPRNMIYMSRLGIWGEGTPFRNFEEFLHAIEKRGVGAMEIV 466

  Fly  1001 AMDMKLRGTYIARQLSFKDVSFRIEEVNMSKEFRKSYNLSAELWADIHKKFQKACRLMCVENRVQ 1065
            |||||:.|.||||||||..|:|||||:.::..|...||.:|.|||:....||:|...:.:|:|  
Human   467 AMDMKVSGMYIARQLSFSGVTFRIEEIPLAPAFECVYNRAALLWAEALNVFQQAADWIGLESR-- 529

  Fly  1066 KIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLN 1130
            |.:..|||.|||||||.||||:||..:|::.|:.....|.||||||||||:||.|.|..:.|.||
Human   530 KSLWGQFWSAHQRFFKYLCIAAKVRRLVELAREELARDKCVVIGLQSTGEARTREVLGENDGHLN 594

  Fly  1131 SFVSTAKMIIQSFVEKHFPAPKRDSFHHLLNTGEFEPEARSRPPKQKKSKMNTDWVEDDMDAEAG 1195
            .|||.|:.:..|.::||||:.||                                   ..|..||
Human   595 CFVSAAEGVFLSLIQKHFPSTKR-----------------------------------KRDRGAG 624

  Fly  1196 ESDIEMYERSCTAAVEKIKSGQKRRGRPPKADKV------------EKITMQERILEHLCNNMRE 1248
            .                 |..::.|||..||.::            :..|..:..|:...|:..|
Human   625 S-----------------KRKRRPRGRGAKAPRLACETAGVIRISDDSSTESDPGLDSDFNSSPE 672

  Fly  1249 QDNED-----ESTNTSDNTKVKVNITERD------VERCINMREMLLEKIDVLGRKLPPNTLDKL 1302
            ...:|     ::.....:.:..:.:.:||      :||...:::.||:|:..|||:||.||||:|
Human   673 SLVDDDVVIVDAVGLPSDDRGPLCLLQRDPHGPGVLERVERLKQDLLDKVRRLGRELPVNTLDEL 737

  Fly  1303 ISELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDLVNYREKQRFMDGSKHVAIISEAA 1367
            |.:|||...|||||||:||||........:|.|.|...::|.||.|||||||.|.|.|||||||:
Human   738 IDQLGGPQRVAEMTGRKGRVVSRPDGTVAFESRAEQGLSIDHVNLREKQRFMSGEKLVAIISEAS 802

  Fly  1368 SSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGERRFAS 1432
            |||:|||:|:||.|||||:|:||||||||||||||||||||||||:||||||:|::|||||||||
Human   803 SSGVSLQADRRVQNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVSAPEYVFLISELAGERRFAS 867

  Fly  1433 TVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLDRSQVPQSYKG-- 1495
            .||||||||||||.||||||::||||::|.:|..|..||..|:..:.|... ::..|||.|.|  
Human   868 IVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTRALHCVLTTILSQTE-NKVPVPQGYPGGV 931

  Fly  1496 -NFIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMYS 1559
             .|..|....:..||:..  .|::.....||||. :|:||||||||..|..|||||::|.|....
Human   932 PTFFRDMKQGLLSVGIGG--RESRNGCLDVEKDC-SITKFLNRILGLEVHKQNALFQYFSDTFDH 993

  Fly  1560 LIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERGMSFETALAK-Y 1623
            ||...||.|::|:|||||......:.......|:............:.::|:||:.:|.|.|| .
Human   994 LIEMDKREGKYDMGILDLAPGIEEIYEESQQVFLAPGHPQDGQVVFYKISVDRGLKWEDAFAKSL 1058

  Fly  1624 RKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASISS 1688
            ...|.|  :|||:..|.|.||.|   ||.|..|....      ..:|:||.|.|.:||...|:..
Human  1059 ALTGPY--DGFYLSYKVRGNKPS---CLLAEQNRGQF------FTVYKPNIGRQSQLEALDSLRR 1112

  Fly  1689 RYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTCPMP---TGCEVGLRMRTYHVLSGLMLPIWDR 1750
            ::.:|:.|||:..|...|.|.|..|||..|||.|.:.   ..|..|||:|.:::|.|.:|.:|.|
Human  1113 KFHRVTAEEAKEPWESGYALSLTHCSHSAWNRHCRLAQEGKDCLQGLRLRHHYMLCGALLRVWGR 1177

  Fly  1751 IELII--VNSGHKIQIIRMKTDANKKIVGTVVP 1781
            |..::  |:|...:||:|:||...||.||..:|
Human  1178 IAAVMADVSSSSYLQIVRLKTKDRKKQVGIKIP 1210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 189/301 (63%)
DEXDc 759..986 CDD:214692 141/227 (62%)
Helicase_C_4 1297..1576 CDD:290582 166/282 (59%)
SBNO2NP_055778.2 AAA_34 218..505 CDD:290583 190/302 (63%)
Helicase_C_4 732..1010 CDD:290582 166/282 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2398469
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6217
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 1 1.000 FOG0005700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 O PTHR12706
Phylome 1 0.910 0.687 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.660

Return to query results.
Submit another query.