DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and Sbno2

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_906271.1 Gene:Sbno2 MGIID:2448490 Length:1349 Species:Mus musculus

Alignment Length:1281 Identity:563/1282 (44%)
Similarity:748/1282 (58%) Gaps:144/1282 (11%)


  Fly   543 SENKAF--PKP---NQVCIPPQPAIPPQPAIPPAPAYCMANKTMDTGMSSVVQMANNPLASTQHH 602
            |||:.|  ..|   .|.|  |:.:.|....:   |::...:.......|.:..::|..:.|:...
Mouse    49 SENQQFVGSTPFLGGQSC--PETSYPTTATV---PSFFSKSSDFPQDPSCLEDLSNASVFSSSVD 108

  Fly   603 ALPQVPIVTR-LKVDQGEDVSVKFTTGLDGLITNVQLLPSTMAMGQPTVKATELESFTAQQLNML 666
            :|..:|.... |:.|...:|                          ||:......|.|..:|  .
Mouse   109 SLSDIPDTPDFLQADSLNEV--------------------------PTIWDVSTTSTTHDKL--F 145

  Fly   667 LQSGHPYLSLPMTNSGVPGAVLQET---LQTKDAGFPSEQAVEDEEVDYEEIGVADTFAAYWPSK 728
            :.||      |.:....|...|..|   :..:....|.|:..|:|| :.||:|.|:|:|.|.|||
Mouse   146 IPSG------PFSAPEDPVTSLSSTPLLISYQSHSQPEEEEGEEEE-ETEELGHAETYADYVPSK 203

  Fly   729 LKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTECLSALQLEAVVYACQAHEQILPSGDRAG 793
            .|.|:.|||.||||:|||||..|:|.|.||||:.....||||||||:.||||.||.:||||.|||
Mouse   204 SKIGKQHPDRVVETSTLSSVPPPDITYTLALPTSDNSTLSALQLEAITYACQQHEVLLPSGQRAG 268

  Fly   794 FLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVATINKFK 858
            ||:|||||||||||:||||.:|||:|||:|||.|.|:|||:||||||.||.| ..|.|..::|.|
Mouse   269 FLIGDGAGVGKGRTVAGIIVENYLRGRKKALWFSASNDLKYDAERDLRDIEA-PGIAVHALSKIK 332

  Fly   859 YSPIDSEENENFKRGVIFCTYTALIGESMTTNSKYKTRFRQLTNWLGKKFEGVIVFDECHKAKNL 923
            |.  |:..:|    ||:|.||:||||||. ...:::||.||:..|.|:.|:|||||||||||||.
Mouse   333 YG--DNTTSE----GVLFATYSALIGESQ-AGGQHRTRLRQILQWCGEGFDGVIVFDECHKAKNA 390

  Fly   924 SLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFYEFVNA 988
            |      |||.|..|||||..||.|||||||||||||||||.||.|||:||.||.:..|.||::|
Mouse   391 S------STKMGKAVLDLQSKLPQARVVYASATGASEPRNMIYMSRLGIWGEGTPFRTFEEFLHA 449

  Fly   989 VEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSKEFRKSYNLSAELWADIHKKFQK 1053
            :||||:|||||||||||:.|.||||||||..|:|||||:.:|..|::.||.:|.|||:....||:
Mouse   450 IEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVTFRIEEIPLSPAFQQVYNRAARLWAEALSVFQQ 514

  Fly  1054 ACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQSTGESRT 1118
            |...:.:|:|  |.:..|||.|||||||.||||:||:.:|::.:|.....|.||||||||||:||
Mouse   515 AADWIGLESR--KSLWGQFWSAHQRFFKYLCIAAKVHRLVELAQQELSRDKCVVIGLQSTGEART 577

  Fly  1119 LEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAPKRDSFHHLLNTGEFEPEARSRPPKQKKSKMNT 1183
            .|.|:.:.|:|:.|||.|:.:..|.::||||:.:|   ......|:.:...|.|.||..:..:..
Mouse   578 REVLDENEGRLDCFVSAAEGVFLSLIQKHFPSTRR---RRDRGGGKRKRRPRGRGPKASRLSLEA 639

  Fly  1184 DWVEDDMDAEAGESDIEM---YERSCTAAVEKIKSGQKRRGRPPKADKVEKITMQERILEHLCNN 1245
            ..|....|..:.|||..:   :..|..:.|:               |.|..:             
Mouse   640 AGVIRISDGSSTESDAGLDSDFNSSPESLVD---------------DDVVIV------------- 676

  Fly  1246 MREQDNEDESTNTSDNTKVKVNITERD------VERCINMREMLLEKIDVLGRKLPPNTLDKLIS 1304
                   |..|:.:|: :..:...:||      |||...:::.||.|:..|||:||.||||:||.
Mouse   677 -------DAPTHPTDD-RGSLYPLQRDLQGPGVVERVERLKQGLLAKVRALGRELPVNTLDQLIH 733

  Fly  1305 ELGGTNLVAEMTGRRGRVVRTEYDGYKYEPRCENDSTMDLVNYREKQRFMDGSKHVAIISEAASS 1369
            :|||...|||||||:||||........:|.|.|...::|.||.|||||||.|.|.|||||||:||
Mouse   734 QLGGPECVAEMTGRKGRVVSRPDGTVVFESRAEQGLSIDHVNLREKQRFMSGEKLVAIISEASSS 798

  Fly  1370 GISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGERRFASTV 1434
            |:|||:|:||.|||||:|:||||||||||||||||||||||||:||||||:|::|||||||||.|
Mouse   799 GVSLQADRRVQNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVSAPEYVFLISELAGERRFASIV 863

  Fly  1435 AKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQL---TSNKPLDRSQVPQSYKGN 1496
            |||||||||||.||||||::||||::|.:|..|..||..|:..:   |.|    |..:||.|.|.
Mouse   864 AKRLESLGALTHGDRRATESRDLSKYNFENKYGARALSRVLATIMGQTDN----RVPLPQGYPGG 924

  Fly  1497 ---FIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMY 1558
               |..|....:..||:.:  .|::.....||||. :|:||||||||..|..|||||::|.|...
Mouse   925 DTAFFRDMKQGLLSVGIGS--RESRSGCLDVEKDC-SITKFLNRILGLEVHKQNALFQYFSDTFD 986

  Fly  1559 SLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRK-HATGTAATELHTVTVERGMSFETALAK 1622
            .||...|:.||:|:|||||......:.......|:.. |...........::|:|||.:|.||.:
Mouse   987 HLIEIDKKEGRYDMGILDLAPGINEIHEESQQVFLAPGHPQDGQVVFYKQISVDRGMKWEEALTR 1051

  Fly  1623 -YRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASI 1686
             ...:|.|  :|||:..|.|.:|.|   ||.|..|..:.      ..:|:||.|.|.:|||..|:
Mouse  1052 SLELKGPY--DGFYLSYKVRGSKMS---CLLAEQNRGEY------FTVYKPNIGRQSQLETLDSL 1105

  Fly  1687 SSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTCPMPTG---CEVGLRMRTYHVLSGLMLPIW 1748
            ..::.:|:.|||:..|...|.|.|..|||..||:.|.:...   |..|||:|.:::|.|.:|.:|
Mouse  1106 CRKFHRVTVEEAREPWESSYALSLEHCSHTTWNQRCRLTQEGKCCAQGLRLRHHYMLCGALLRVW 1170

  Fly  1749 DRIELII--VNSGHKIQIIRMKTDANKKIVGTVVPPAVYDDLVADL 1792
            .||..::  |:|...:||:|:||...||.||..:|......::.:|
Mouse  1171 GRIAAVMADVSSSSYLQIVRLKTKDKKKQVGIKIPEGCVHRVLQEL 1216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 191/301 (63%)
DEXDc 759..986 CDD:214692 142/227 (63%)
Helicase_C_4 1297..1576 CDD:290582 167/285 (59%)
Sbno2NP_906271.1 AAA_34 212..500 CDD:290583 192/302 (64%)
Helicase_C_4 726..1004 CDD:290582 167/285 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2397716
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6217
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 1 1.000 FOG0005700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 O PTHR12706
Phylome 1 0.910 0.687 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.660

Return to query results.
Submit another query.