DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3491 and let-765

Sequence 1:NP_609731.1 Gene:CG3491 FlyBaseID:FBgn0028887 Length:1801 Species:Drosophila melanogaster
Sequence 2:NP_498455.2 Gene:let-765 WormBaseID:WBGene00002889 Length:1866 Species:Caenorhabditis elegans

Alignment Length:2000 Identity:685/2000 (34%)
Similarity:950/2000 (48%) Gaps:443/2000 (22%)


  Fly    74 QKSQLMTESAGKFDSETKRKRQATVSGSKSQLLDELASDSDN---YVKQLRTFLRSTSNTD---- 131
            |.|...:.|....|...:.....|.:.|.||..||.::||.:   |...:.|...||.:..    
 Worm    20 QSSPTPSTSGSIHDDAGQSFSNNTHTPSVSQFFDETSNDSHSSSAYYTPMATPFVSTEDGGVPTS 84

  Fly   132 ----DEQKRDSPARQSRSRSRRRCTQKNENLDE-PDQNTIFKKPEVSSKINLEKHNQRTSTDKEK 191
                ||:........:..      |..:.|:|. .|.......|.|  |:...||...|....|.
 Worm    85 FFGMDEEDGGCTIMTTAG------TSGSNNIDGIEDAGGGMYYPHV--KVIPRKHTAPTVNQSEP 141

  Fly   192 QYKGQKLNSSIESIL---NVYDELPSHSDNQALNLSQKRNNAWTTKLPESSPKNIPKKNFDSKSS 253
            ......:....|..|   |..|. |:.|.:.:...|.:.|:....:...|..:| |.....::|:
 Worm   142 STPTVTIVPKKEDPLFETNTADS-PTPSGDTSTTASYEGNDGLEDQETTSDRQN-PMFVQTARST 204

  Fly   254 D--LEEAEEK--------TYLKRQSERNFYSGYRSESEGTNITPAKRS-KAQINSIPKLEYSTTY 307
            |  |:.....        :.|.::|..:  |...|.||||.:.|.|:. .....||.|....|..
 Worm   205 DGRLDTPSTSATVSPHITSSLTQRSHTS--SPASSASEGTVVPPRKKGLPITTGSIVKRTVQTKD 267

  Fly   308 G-QAQNL--VVSENANITQKPSSDIKSR--YRSTEYNQINKPDSQQPINYAHQKEETIDRRREMH 367
            | |.|.|  .|:||.....|..|.:.:.  .|.|....:.:..|            ||.|...|.
 Worm   268 GLQTQYLKAFVNENGEKIYKLLSPVAASAVARGTLPPGMGRGGS------------TIGRGGTMV 320

  Fly   368 MRKEHQ--YVDNHLNNPAQNKPDRTVSFLEMLSQAEAKKESN--QGAKKPTVNKV--SNVSQYLI 426
            .:...:  .|.||:.      |:..:....|:|.|..:..:|  ||..:|....|  ||...:|:
 Worm   321 NKNGERLMVVKNHVG------PNGQMLVKRMVSPAGTRIVANGGQGRGQPIYRAVDGSNGPTHLL 379

  Fly   427 DLGFTAGSPNHDSN--------------SNDGNDEQDNIDRRLNADLDSLFTTDELACPPPPPLA 477
            ....|.|.|...:.              ...||..:.|:..|....                   
 Worm   380 RRTTTTGQPTRGAPVGMAARHAVRGGTVYGGGNGYRVNLVGRGTGG------------------- 425

  Fly   478 KIPTNLTVERPHSRLSDPKKIESDIDARLQAELDSLPMVAVPADENIEPLGK----------TDQ 532
               :.:...:|.:|:|                          :..::.|:|:          ..|
 Worm   426 ---STMVHHQPLNRIS--------------------------SQRSVAPVGRVLNRGALRNGAQQ 461

  Fly   533 HFSVPTNK---NLSENKAFPKPNQVCIPPQPAIP-----------PQPAIPP-APAYCMANK-TM 581
            ...|.|:.   :..|.:..|..|.:.|  |...|           .|.:.|. .||..:.|: :.
 Worm   462 PLHVSTSSPAFHYMEEQPSPTTNGMVI--QAKTPGAGVIQARHMQSQQSFPSGGPARVLMNRSST 524

  Fly   582 DTGMSSVVQMANNPLASTQHHALPQVPIVTRLKVDQGEDVSVKFTTGLDGLITNVQLLPST---- 642
            :.|:|.:|       .......||..|                     :|.:    ::|||    
 Worm   525 NAGLSRMV-------GGGYDQQLPTAP---------------------NGRL----MIPSTAVRV 557

  Fly   643 --MAMGQPTVKATELESFTAQ----QLNMLLQSGHPYLSLPMTNSGVPGAVLQETLQTKDAGFPS 701
              ..|..|.::.|......:|    ::.|..|.|.                 :|.||        
 Worm   558 PGSGMASPRLQTTPQPLTKSQKAKDEMKMAYQVGR-----------------EEALQ-------- 597

  Fly   702 EQAVEDEEVDYEEIGVADTFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTEC 766
             |...|.|.|.|.:|.|:|::.|.|:||:.|.||||.|||:|:||||..|::.||:::|....:.
 Worm   598 -QRRNDLEDDEENLGYAETYSEYTPAKLRSGMAHPDSVVESASLSSVSPPDVKYQISIPEYLIDM 661

  Fly   767 --LSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVS 829
              :||||||||:||||.||:.:|||:|.|:|:|||||||||||:|.|||:|||:|||||:|:|||
 Worm   662 GHISALQLEAVIYACQMHERRMPSGERYGYLIGDGAGVGKGRTVACIIFENYLQGRKRAIWLSVS 726

  Fly   830 SDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMTTNS-KY 893
            |||||||||||.|.|| ..|.|..:||.||:.|..:||.:.|:||:|.|||:||||.....| ||
 Worm   727 SDLKFDAERDLRDCGA-PNIPVYALNKMKYAKISGKENGSIKKGVMFATYTSLIGECRGAKSRKY 790

  Fly   894 KTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGA 958
            ::|..||..|.|:.::|||:.||||:||||......|.||||..||:|||.||||||||||||||
 Worm   791 RSRISQLIQWFGQDYDGVIILDECHRAKNLVPTAGAKPTKTGRMVLELQKALPNARVVYASATGA 855

  Fly   959 SEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFR 1023
            :||||||||.||||||...|:|||::|::|||:||:|||||||||||.||.|:||||||:.|||.
 Worm   856 TEPRNMAYMTRLGLWGERQAFPEFHDFISAVERRGVGAMEIVAMDMKQRGLYLARQLSFRGVSFA 920

  Fly  1024 IEEVNMSKEFRKSYNLSAELWADIHKKFQKACRLMCVENR-VQKIITCQFWCAHQRFFKNLCIAS 1087
            ::||.:|.||.|.|:.:.:||.:..::||.....|..|.| ..|.:..|||..||||||.||||:
 Worm   921 VQEVQLSSEFVKMYDAAVKLWMEARRQFQTVIETMDEEERSTCKTVWGQFWACHQRFFKYLCIAA 985

  Fly  1088 KVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAP- 1151
            ||:..|:::|:|.:..|.|||||||||||.|||.||...|:||.||||||.::...::||||.. 
 Worm   986 KVDTCVQLSREAIKAKKCVVIGLQSTGESATLETLEEMGGELNEFVSTAKTVLYGLIDKHFPTDA 1050

  Fly  1152 -----KRDSFHHLLNTGEFEPEARSRPPKQKKSKM------------------------------ 1181
                 .||.|.   :..:||     ||.|::|::.                              
 Worm  1051 SFSMGDRDIFK---DFDDFE-----RPAKRRKTRETLSFLGDVGFDTWTGVTTGMGGRVGDGVTK 1107

  Fly  1182 -------------------NT-----------------DWVEDDMDAE-AGES-DIEM------- 1201
                               ||                 |.||:||.:| .||| |:|.       
 Worm  1108 NITRGLSGIGRSSMSSSTGNTNNEDANSTTSESSDGSDDEVENDMISENGGESGDLESAREEAEG 1172

  Fly  1202 -------------------YERSCTAAVEKI------------KSGQKR---------------- 1219
                               .|.|...:.|::            |||:..                
 Worm  1173 ARTLEDGEQDEWVKALLAEAESSSDDSDEEVVKDEDEDEEAESKSGETHEQEEEFNPFMCDFTND 1237

  Fly  1220 ----------RGRPPKADKVEKITMQERILEHLCNNMREQDN-------------EDESTNTSDN 1261
                      ...|.|..|.:|....|...|.|...:|:::.             |.|....::.
 Worm  1238 DPWAHNQQIVEDTPQKDRKAKKRKRDEEEAERLREKVRKREERREKKRRRAIRRAEREKQRRNEE 1302

  Fly  1262 TKVKVNIT--------------ERDVERCINMREMLLEKIDVLGRKLPPNTLDKLISELGGTNLV 1312
            .:.:.:.|              |:|....:.::..||..::.|...||.||||:||.|:||...|
 Worm  1303 LQARGSATDFITSSRICGNGSGEQDDINPMLIKTELLAAVERLAPSLPANTLDQLIDEMGGPEYV 1367

  Fly  1313 AEMTGRRGRVVRTEYDGYKYEPRCEN-DSTMDLVNYREKQRFMDGSKHVAIISEAASSGISLQSD 1376
            ||||||||.:|.:|.....|:.|..| :.:::|:|..||::||.|.|.:||||||||||||||||
 Worm  1368 AEMTGRRGHMVTSETGDVMYQRRNANAEVSLELINMEEKEKFMRGEKLIAIISEAASSGISLQSD 1432

  Fly  1377 KRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGERRFASTVAKRLESL 1441
            :|..|:|||:|||||||||||:||||||||||||||:.|||||:|::||||:||||.||||||||
 Worm  1433 RRAINKRRRVHITLELPWSADKAIQQFGRTHRSNQVSGPEYVFLISELAGEKRFASIVAKRLESL 1497

  Fly  1442 GALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLDRSQVPQSYK-GNFIYDCCVAM 1505
            ||||.||||||:.|||||||:||..||.||:.:::.:...........|:.|| |.|..|..:.|
 Worm  1498 GALTHGDRRATETRDLSQFNMDNKYGRVALDTLLKTVIGQAGTPLIDPPKDYKAGEFFEDMRLYM 1562

  Fly  1506 AGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRF 1570
            .|||::   .:||...:|:||::..|.||||||||..|..||:||.:|.:.:..||.|.|..|.:
 Worm  1563 EGVGLL---AKNKTGQYTIEKEAATIPKFLNRILGLPVHAQNSLFHYFSEIVAELIAQSKHDGTY 1624

  Fly  1571 DLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERGMSFETALAKYRKEGQYEHEGFY 1635
            |.||:||......|:.::...|..:...|:...|:|.:.||||:|:|.|: :..||...:.:|||
 Worm  1625 DTGIMDLGTGDDQVRKLETRVFTGRVDNGSFRVEIHKIGVERGVSWEEAM-ELHKEHSNDDDGFY 1688

  Fly  1636 ILQKRRQNKNSAILCLQAPSNSSDVSN--------GKINLQ-------IYRPNTGPQVRLETHAS 1685
            |             |....:|:::...        |||.:.       |.||:||...:|.|.|.
 Worm  1689 I-------------CHPGGANTANTKKVAALVYGIGKIRMDNGARLYAITRPSTGRSPKLMTMAD 1740

  Fly  1686 ISSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTCPMP---TGCEVGLRMRTYHVLSGLMLPI 1747
            :|.|:.|||.:||:..|.|||:...|||.|.|....|...   |.||||.|.|||.||||.:|.:
 Worm  1741 LSKRFHKVSIDEAKEVWKQQYDSAANMCQHNYVYGKCRTESNGTYCEVGRRTRTYFVLSGSVLSV 1805

  Fly  1748 WDRIELIIVNSGHK---IQIIRMKTDANKKIVGTVVPPAVYDDLVADLST 1794
            |..:|.::..|..|   :|:||::|:.::||||.:|.|.....||..|.|
 Worm  1806 WPIVEEVLAGSDRKSSRMQVIRVRTEQDQKIVGLLVLPTHVRHLVQQLET 1855

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3491NP_609731.1 AAA_34 737..1038 CDD:290583 191/304 (63%)
DEXDc 759..986 CDD:214692 144/230 (63%)
Helicase_C_4 1297..1576 CDD:290582 160/281 (57%)
let-765NP_498455.2 AAA_34 632..936 CDD:290583 191/305 (63%)
Helicase_C_4 1352..1630 CDD:290582 160/281 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133411321
eggNOG 1 0.900 E1_KOG1513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D112455at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374919
orthoMCL 1 0.900 OOG5_129178
Panther 1 1.100 O PTHR12706
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.710

Return to query results.
Submit another query.